Project name: SH3_Y92C

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	YA92C
Energy difference between WT (input) and mutated protein (by FoldX)	3.54212 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.5126
• Maximal score value: 1.2501
• Average score: -0.9539
• Total score value: -57.2314

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1008
87	V	A	-0.6175
88	A	A	0.0000
89	L	A	-0.3143
90	Y	A	-0.7548
91	D	A	-2.9020
92	C	A	-2.2392	mutated: YA92C
93	E	A	-2.9740
94	S	A	-2.2740
95	R	A	-2.8391
96	T	A	-2.2100
97	E	A	-2.4004
98	T	A	-1.3182
99	D	A	-1.4887
100	L	A	0.0000
101	S	A	-1.9897
102	F	A	0.0000
103	K	A	-3.5126
104	K	A	-2.8749
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4375
111	V	A	1.2501
112	N	A	-0.4097
113	N	A	-1.7989
114	T	A	-1.7223
115	E	A	-2.9157
116	G	A	-2.5907
117	D	A	-2.6546
118	W	A	-1.2908
119	W	A	-0.6832
120	L	A	0.3960
121	A	A	0.0000
122	H	A	-0.3837
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8786
127	G	A	-0.8169
128	Q	A	-1.4280
129	T	A	-0.5216
130	G	A	0.0000
131	Y	A	0.1697
132	I	A	0.0000
133	P	A	-0.5571
134	S	A	-1.2630
135	N	A	-1.2301
136	Y	A	-0.1882
137	V	A	0.0000
138	A	A	-0.0145
139	P	A	-0.1505
140	S	A	-0.1759