Project name: SH3_W119S

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	WA119S
Energy difference between WT (input) and mutated protein (by FoldX)	3.34005 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.3066
• Average score: -0.8726
• Total score value: -52.3572

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4337
82	S	A	-0.6670
83	H	A	-0.7912
84	M	A	0.3089
85	T	A	0.0000
86	F	A	0.0717
87	V	A	-0.5146
88	A	A	0.0000
89	L	A	-0.2394
90	Y	A	-0.7045
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1629
97	E	A	-2.3616
98	T	A	-1.2587
99	D	A	-1.3766
100	L	A	0.0000
101	S	A	-1.9146
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8367
105	G	A	-1.9280
106	E	A	0.0000
107	R	A	-2.0082
108	L	A	0.0000
109	Q	A	-0.1453
110	I	A	0.5841
111	V	A	1.3066
112	N	A	-0.3914
113	N	A	-1.8396
114	T	A	-1.7534
115	E	A	-2.9794
116	G	A	-2.6554
117	D	A	-2.7582
118	W	A	-1.4787
119	S	A	0.0000	mutated: WA119S
120	L	A	0.3562
121	A	A	0.0000
122	H	A	-0.3679
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4906
130	G	A	0.0000
131	Y	A	0.1013
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3159
135	N	A	-1.2288
136	Y	A	-0.1165
137	V	A	-0.0205
138	A	A	0.0964
139	P	A	-0.0520
140	S	A	-0.1171