Project name: 8a07c1f8afa6e9d [mutate: AA315T]

Status: done

submitted: 2018-10-27 04:38:28, status changed: 2018-10-27 04:46:48
Settings
Chain sequence(s) A: MNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQ
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues AA315T
Energy difference between WT (input) and mutated protein (by FoldX) 0.0416672 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.1876
Maximal score value
2.3219
Average score
-0.4553
Total score value
-22.7669

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
311 M A 0.8354
312 N A 0.0699
313 F A 1.5417
314 G A 1.1225
315 T A 1.3121 mutated: AA315T
316 F A 2.3219
317 S A 1.5400
318 I A 1.7463
319 N A -0.0032
320 P A 0.2217
321 A A 0.5415
322 M A 1.2387
323 M A 0.9360
324 A A 0.4481
325 A A 0.4307
326 A A 0.3031
327 Q A -0.2256
328 A A -0.1791
329 A A -0.1014
330 L A 0.1678
331 Q A -0.5916
332 S A -0.1257
333 S A 0.3448
334 W A 1.1553
335 G A 0.4080
336 M A 1.2914
337 M A 1.4408
338 G A 0.4817
339 M A 0.6429
340 L A 0.2592
341 A A -0.6491
342 S A -1.0420
343 Q A -2.0652
344 Q A -2.8375
345 N A -2.7312
346 Q A -2.5785
347 S A -2.2528
348 G A -1.6474
349 P A -1.4970
350 S A -1.3130
351 G A -2.1415
352 N A -3.0669
353 N A -2.9055
354 Q A -3.1876
355 N A -2.9863
356 Q A -2.9522
357 G A -2.5582
358 N A -2.1058
359 M A -0.4648
360 Q A -1.3593

 

Laboratory of Theory of Biopolymers 2015