Project name: SH3_R107M

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	RA107M
Energy difference between WT (input) and mutated protein (by FoldX)	-0.310806 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.2532
• Maximal score value: 1.2257
• Average score: -0.7685
• Total score value: -46.1116

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4605
82	S	A	-0.6955
83	H	A	-0.8015
84	M	A	0.2465
85	T	A	0.2444
86	F	A	0.4590
87	V	A	0.0874
88	A	A	0.0000
89	L	A	-0.3270
90	Y	A	-0.7433
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2408
99	D	A	-1.3223
100	L	A	0.0000
101	S	A	-1.9031
102	F	A	0.0000
103	K	A	-3.2532
104	K	A	-2.5936
105	G	A	-1.4501
106	E	A	0.0000
107	M	A	0.0569	mutated: RA107M
108	L	A	0.0000
109	Q	A	0.1320
110	I	A	0.6117
111	V	A	1.2257
112	N	A	-0.4305
113	N	A	-1.8138
114	T	A	-1.7326
115	E	A	-2.9361
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3421
119	W	A	-0.6994
120	L	A	0.3917
121	A	A	0.0000
122	H	A	-0.1038
123	S	A	0.0000
124	L	A	0.4259
125	T	A	-0.1043
126	T	A	-0.5655
127	G	A	-0.7869
128	Q	A	-1.3989
129	T	A	-0.4993
130	G	A	0.0000
131	Y	A	0.2176
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2855
135	N	A	-1.2485
136	Y	A	-0.2122
137	V	A	0.0000
138	A	A	-0.0406
139	P	A	0.0607
140	S	A	0.1428