Project name: SH3_F86Y

Status: done

submitted: 2019-03-14 15:10:34, status changed: 2019-03-14 15:36:41
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues FA86Y
Energy difference between WT (input) and mutated protein (by FoldX) 0.537827 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4838
Maximal score value
1.2324
Average score
-0.9005
Total score value
-54.0325

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4549
82 S A -0.6861
83 H A -0.7912
84 M A 0.2545
85 T A 0.0000
86 Y A -0.1451 mutated: FA86Y
87 V A -0.6392
88 A A 0.0000
89 L A -0.3167
90 Y A -0.7367
91 D A -2.8528
92 Y A -2.1055
93 E A -2.8815
94 S A 0.0000
95 R A -2.7837
96 T A -2.1540
97 E A -2.3526
98 T A -1.2414
99 D A -1.3238
100 L A 0.0000
101 S A -1.9034
102 F A 0.0000
103 K A -3.4838
104 K A -2.8616
105 G A -1.9663
106 E A 0.0000
107 R A -2.0845
108 L A 0.0000
109 Q A -0.2737
110 I A 0.3961
111 V A 1.2324
112 N A -0.4317
113 N A -1.8246
114 T A -1.7344
115 E A -2.9383
116 G A -2.6102
117 D A -2.6863
118 W A -1.3465
119 W A -0.7135
120 L A 0.3919
121 A A 0.0000
122 H A -0.3930
123 S A 0.0000
124 L A -0.2796
125 T A -0.7803
126 T A -0.8780
127 G A -0.8169
128 Q A -1.4119
129 T A -0.4983
130 G A 0.0000
131 Y A 0.2131
132 I A 0.0000
133 P A 0.0000
134 S A -1.2914
135 N A -1.2493
136 Y A -0.2076
137 V A 0.0000
138 A A -0.0327
139 P A -0.1691
140 S A -0.1884

 

Laboratory of Theory of Biopolymers 2015