Project name: SH3_Y92L

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	YA92L
Energy difference between WT (input) and mutated protein (by FoldX)	1.97504 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4913
• Maximal score value: 1.2498
• Average score: -0.9368
• Total score value: -56.2099

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1035
87	V	A	-0.6211
88	A	A	0.0000
89	L	A	-0.3131
90	Y	A	-0.7415
91	D	A	-2.8657
92	L	A	-2.1497	mutated: YA92L
93	E	A	-2.9211
94	S	A	-2.2287
95	R	A	-2.8163
96	T	A	-2.1912
97	E	A	-2.3843
98	T	A	-1.2918
99	D	A	-1.4237
100	L	A	0.0000
101	S	A	-1.9446
102	F	A	0.0000
103	K	A	-3.4913
104	K	A	-2.8651
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4372
111	V	A	1.2498
112	N	A	-0.4123
113	N	A	-1.8026
114	T	A	-1.7247
115	E	A	-2.9203
116	G	A	-2.5922
117	D	A	-2.6562
118	W	A	-1.2952
119	W	A	-0.6804
120	L	A	0.4024
121	A	A	0.0000
122	H	A	-0.3840
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8781
127	G	A	-0.8169
128	Q	A	-1.4220
129	T	A	-0.5122
130	G	A	0.0000
131	Y	A	0.1916
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2643
135	N	A	-1.2363
136	Y	A	-0.1941
137	V	A	0.0000
138	A	A	-0.0195
139	P	A	-0.1505
140	S	A	-0.1759