Project name: SH3_Y92E

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	YA92E
Energy difference between WT (input) and mutated protein (by FoldX)	3.4812 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.6686
• Maximal score value: 1.2501
• Average score: -0.9955
• Total score value: -59.7306

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1077
87	V	A	-0.6262
88	A	A	0.0000
89	L	A	-0.4038
90	Y	A	-0.9213
91	D	A	-3.2137
92	E	A	-2.8717	mutated: YA92E
93	E	A	-3.2752
94	S	A	-2.4181
95	R	A	-2.8989
96	T	A	-2.2074
97	E	A	-2.3992
98	T	A	-1.3167
99	D	A	-1.5538
100	L	A	0.0000
101	S	A	-2.1836
102	F	A	0.0000
103	K	A	-3.6686
104	K	A	-2.9837
105	G	A	-1.9610
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4375
111	V	A	1.2501
112	N	A	-0.4077
113	N	A	-1.7958
114	T	A	-1.7202
115	E	A	-2.9115
116	G	A	-2.5864
117	D	A	-2.6472
118	W	A	-1.2823
119	W	A	-0.6758
120	L	A	0.3993
121	A	A	0.0000
122	H	A	-0.3837
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8781
127	G	A	-0.8169
128	Q	A	-1.4274
129	T	A	-0.5210
130	G	A	0.0000
131	Y	A	0.1753
132	I	A	0.0000
133	P	A	-0.6528
134	S	A	-1.2787
135	N	A	-1.2580
136	Y	A	-0.3463
137	V	A	0.0000
138	A	A	-0.0276
139	P	A	-0.1505
140	S	A	-0.1759