Project name: SH3_Q109P

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	QA109P
Energy difference between WT (input) and mutated protein (by FoldX)	2.21875 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.4218
• Average score: -0.8319
• Total score value: -49.9163

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.3749
82	S	A	-0.5813
83	H	A	-0.7194
84	M	A	0.3972
85	T	A	0.0000
86	F	A	0.0625
87	V	A	-0.5372
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3230
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-1.8100
108	L	A	0.0000
109	P	A	0.4762	mutated: QA109P
110	I	A	0.7536
111	V	A	1.4218
112	N	A	-0.3442
113	N	A	-1.8121
114	T	A	-1.7330
115	E	A	-2.9365
116	G	A	-2.6087
117	D	A	-2.6847
118	W	A	-1.3429
119	W	A	-0.7006
120	L	A	0.4889
121	A	A	0.0000
122	H	A	-0.0877
123	S	A	0.0000
124	L	A	0.2654
125	T	A	-0.5809
126	T	A	-0.7572
127	G	A	-0.6856
128	Q	A	-1.3469
129	T	A	-0.3828
130	G	A	0.0000
131	Y	A	0.2148
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2847
135	N	A	-1.2486
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.0812
140	S	A	-0.1759