Project name: SH3_S140D

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	SA140D
Energy difference between WT (input) and mutated protein (by FoldX)	0.248954 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4944
• Maximal score value: 1.2508
• Average score: -0.9739
• Total score value: -58.4344

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4506
82	S	A	-0.6820
83	H	A	-0.7908
84	M	A	-0.0624
85	T	A	0.0000
86	F	A	-0.7266
87	V	A	-1.1854
88	A	A	0.0000
89	L	A	-0.3381
90	Y	A	-0.7487
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3229
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4944
104	K	A	-2.8802
105	G	A	-1.9921
106	E	A	0.0000
107	R	A	-2.3531
108	L	A	0.0000
109	Q	A	-0.2574
110	I	A	0.4390
111	V	A	1.2508
112	N	A	-0.4196
113	N	A	-1.8142
114	T	A	-1.7328
115	E	A	-2.9363
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3424
119	W	A	-0.6978
120	L	A	0.4052
121	A	A	0.0000
122	H	A	-0.3815
123	S	A	0.0000
124	L	A	-0.2741
125	T	A	-0.7780
126	T	A	-0.8766
127	G	A	-0.8153
128	Q	A	-1.4110
129	T	A	-0.4939
130	G	A	0.0000
131	Y	A	0.2197
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2857
135	N	A	-1.2485
136	Y	A	-0.2184
137	V	A	0.0000
138	A	A	-0.4427
139	P	A	-0.9465
140	D	A	-1.7813	mutated: SA140D