Project name: SH3_S134W

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	SA134W
Energy difference between WT (input) and mutated protein (by FoldX)	-0.0264026 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4853
• Maximal score value: 1.2399
• Average score: -0.8383
• Total score value: -50.2999

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1044
87	V	A	-0.6230
88	A	A	0.0000
89	L	A	-0.3153
90	Y	A	-0.7424
91	D	A	-2.8556
92	Y	A	-2.1070
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3286
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4853
104	K	A	-2.8640
105	G	A	-1.9631
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.5331
111	V	A	1.2399
112	N	A	-0.4355
113	N	A	-1.6965
114	T	A	-1.7424
115	E	A	-2.8316
116	G	A	-2.4111
117	D	A	-2.3819
118	W	A	-1.0495
119	W	A	-0.4766
120	L	A	0.4991
121	A	A	0.0000
122	H	A	-0.3894
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4950
130	G	A	0.0000
131	Y	A	0.3336
132	I	A	0.0000
133	P	A	0.0000
134	W	A	-0.3029	mutated: SA134W
135	N	A	-0.7670
136	Y	A	0.1173
137	V	A	0.0000
138	A	A	0.1334
139	P	A	-0.1505
140	S	A	-0.1759