Project name: SH3_G105T

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	GA105T
Energy difference between WT (input) and mutated protein (by FoldX)	4.60192 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.3381
• Maximal score value: 1.2498
• Average score: -0.8722
• Total score value: -52.3313

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.0577
87	V	A	-0.4994
88	A	A	0.0000
89	L	A	-0.2060
90	Y	A	-0.6541
91	D	A	-2.7777
92	Y	A	-2.0945
93	E	A	-2.8748
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3229
100	L	A	0.0000
101	S	A	-1.8945
102	F	A	0.0000
103	K	A	-3.3381
104	K	A	-2.6474
105	T	A	-1.5562	mutated: GA105T
106	E	A	0.0000
107	R	A	-1.9704
108	L	A	0.0000
109	Q	A	-0.2495
110	I	A	0.4372
111	V	A	1.2498
112	N	A	-0.4200
113	N	A	-1.8142
114	T	A	-1.7328
115	E	A	-2.9363
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3424
119	W	A	-0.6978
120	L	A	0.4047
121	A	A	0.0000
122	H	A	-0.3840
123	S	A	0.0000
124	L	A	-0.2797
125	T	A	-0.7244
126	T	A	-0.8732
127	G	A	-0.8169
128	Q	A	-1.4118
129	T	A	-0.4949
130	G	A	0.0000
131	Y	A	0.2197
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2857
135	N	A	-1.2485
136	Y	A	-0.2043
137	V	A	0.0000
138	A	A	-0.0221
139	P	A	-0.1512
140	S	A	-0.1767