Project name: SH3_W119N

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	WA119N
Energy difference between WT (input) and mutated protein (by FoldX)	3.94815 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.1852
• Average score: -0.9158
• Total score value: -54.9497

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4525
82	S	A	-0.6839
83	H	A	-0.7912
84	M	A	0.2864
85	T	A	0.0000
86	F	A	-0.0100
87	V	A	-0.5746
88	A	A	0.0000
89	L	A	-0.3008
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3574
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9503
106	E	A	0.0000
107	R	A	-2.0449
108	L	A	0.0000
109	Q	A	-0.2301
110	I	A	0.3728
111	V	A	1.1852
112	N	A	-0.5144
113	N	A	-1.9342
114	T	A	-1.7906
115	E	A	-3.0119
116	G	A	-2.6755
117	D	A	-2.7611
118	W	A	-1.4985
119	N	A	-1.0110	mutated: WA119N
120	L	A	0.2500
121	A	A	0.0000
122	H	A	-0.4190
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4962
130	G	A	0.0000
131	Y	A	0.1128
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3920
135	N	A	-1.2908
136	Y	A	-0.2005
137	V	A	0.0000
138	A	A	0.0075
139	P	A	-0.1087
140	S	A	-0.1406