Project name: SH3_T114P

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	TA114P
Energy difference between WT (input) and mutated protein (by FoldX)	1.28616 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 0.7309
• Average score: -0.943
• Total score value: -56.5819

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4903
82	S	A	-0.6764
83	H	A	-0.7912
84	M	A	0.2751
85	T	A	0.0000
86	F	A	-0.0932
87	V	A	-0.6223
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1493
97	E	A	-2.3478
98	T	A	-1.2298
99	D	A	-1.3056
100	L	A	0.0000
101	S	A	-1.8975
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0657
108	L	A	0.0000
109	Q	A	-0.3621
110	I	A	0.2261
111	V	A	0.7309
112	N	A	-0.9501
113	N	A	-2.1285
114	P	A	-2.0546	mutated: TA114P
115	E	A	-3.0825
116	G	A	-2.6864
117	D	A	-2.7069
118	W	A	-1.4074
119	W	A	-0.8834
120	L	A	0.1707
121	A	A	0.0000
122	H	A	-0.4861
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.5269
130	G	A	0.0000
131	Y	A	0.1803
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2775
135	N	A	-1.2501
136	Y	A	-0.2047
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1447
140	S	A	-0.1759