Project name: 12_wo [mutate: NA267S]

Status: done

submitted: 2018-11-07 12:31:34, status changed: 2018-11-07 12:41:35
Settings
Chain sequence(s) A: KTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQ
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues NA267S
Energy difference between WT (input) and mutated protein (by FoldX) -0.0389615 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.6808
Maximal score value
0.6776
Average score
-1.1893
Total score value
-199.7995

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
102 K A -2.6849
103 T A -1.7729
104 S A 0.0000
105 D A 0.0000
106 L A 0.0000
107 I A 0.0076
108 V A 0.0000
109 L A 0.0704
110 G A -0.2363
111 L A 0.0000
112 P A -0.6941
113 W A -0.4128
114 K A -1.6635
115 T A -1.6570
116 T A -1.4446
117 E A -1.9352
118 Q A -2.4627
119 D A -2.5760
120 L A 0.0000
121 K A -2.2536
122 E A -2.7078
123 Y A -1.2972
124 F A 0.0000
125 S A -1.1269
126 T A -0.5845
127 F A -0.4399
128 G A -1.2614
129 E A -1.8099
130 V A 0.0000
131 L A 0.6776
132 M A 0.0000
133 V A 0.0000
134 Q A 0.0000
135 V A -0.6011
136 K A -1.3524
137 K A -2.1203
138 D A -1.5285
139 L A -0.3422
140 K A -1.4256
141 T A -1.3511
142 G A -1.3724
143 H A -2.0814
144 S A -1.8953
145 K A -2.3951
146 G A 0.0000
147 F A 0.0000
148 G A 0.0000
149 F A 0.1462
150 V A 0.0000
151 R A -0.1431
152 F A 0.0000
153 T A -1.1887
154 E A -2.4317
155 Y A -1.6975
156 E A -2.1388
157 T A 0.0000
158 Q A 0.0000
159 V A -0.6635
160 K A -0.9670
161 V A 0.0000
162 M A -0.7973
163 S A -1.1560
164 Q A -2.1117
165 R A -2.2467
166 H A 0.0000
167 M A -0.4522
168 I A 0.0000
169 D A -2.4510
170 G A -1.5878
171 R A -1.4521
172 W A -0.3381
173 C A 0.0000
174 D A -1.1490
175 C A 0.0000
176 K A -0.9844
177 L A -0.4787
178 P A -0.9225
179 N A -1.6206
180 S A -1.2748
181 K A -1.6146
182 Q A -2.2765
183 S A -2.0845
184 Q A -3.0714
185 D A -3.5682
186 E A -2.8367
187 P A -1.4335
188 L A -0.4245
189 R A -2.6586
190 S A -3.1639
191 R A -3.0998
192 K A -2.4959
193 V A 0.0000
194 F A -0.0774
195 V A 0.0000
196 G A 0.0000
197 R A -1.2689
198 C A 0.0000
199 T A -1.6950
200 E A -2.6863
201 D A -2.9879
202 M A 0.0000
203 T A -1.8890
204 E A -1.9714
205 D A -3.2244
206 E A -3.0082
207 L A 0.0000
208 R A -3.0247
209 E A -3.2673
210 F A -1.8738
211 F A 0.0000
212 S A -1.6295
213 Q A -1.6888
214 Y A -0.4529
215 G A -1.2934
216 D A -1.9581
217 V A 0.0000
218 M A -0.7898
219 D A -1.8131
220 V A -1.0553
221 F A 0.3122
222 I A 0.0000
223 P A -0.8231
224 K A -1.8953
225 P A -1.6455
226 F A -1.3327
227 R A -1.8669
228 A A -0.8600
229 F A -0.0001
230 A A 0.0000
231 F A 0.2377
232 V A 0.0000
233 T A -1.3036
234 F A 0.0000
235 A A -1.6271
236 D A -2.5432
237 D A -3.6808
238 Q A -2.9785
239 I A -1.9657
240 A A 0.0000
241 Q A -2.3529
242 S A -1.4152
243 L A 0.0000
244 C A 0.0000
245 G A -1.9417
246 E A -2.1152
247 D A 0.0000
248 L A 0.0000
249 I A -0.1098
250 I A 0.0000
251 K A -1.9439
252 G A -0.7533
253 I A -0.6418
254 S A 0.0000
255 V A 0.0000
256 H A -0.6872
257 I A 0.0000
258 S A -0.7112
259 N A -1.3874
260 A A 0.0000
261 E A -2.8638
262 P A -2.8258
263 K A -3.2195
264 H A -2.7064
265 N A -2.9796
266 S A -2.3603
267 S A -2.2971 mutated: NA267S
268 R A -2.8817
269 Q A -2.4118

 

Laboratory of Theory of Biopolymers 2015