Project name: SH3_W118G

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	WA118G
Energy difference between WT (input) and mutated protein (by FoldX)	3.52691 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4587
• Maximal score value: 1.2645
• Average score: -0.9372
• Total score value: -56.2291

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1038
87	V	A	-0.6194
88	A	A	0.0000
89	L	A	-0.2931
90	Y	A	-0.6978
91	D	A	-2.8036
92	Y	A	-2.0423
93	E	A	-2.8647
94	S	A	0.0000
95	R	A	-2.8056
96	T	A	-2.1809
97	E	A	-2.3758
98	T	A	-1.2666
99	D	A	-1.4553
100	L	A	0.0000
101	S	A	-1.8874
102	F	A	0.0000
103	K	A	-3.4587
104	K	A	-2.8402
105	G	A	-1.9589
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2517
110	I	A	0.4550
111	V	A	1.2645
112	N	A	-0.4775
113	N	A	-1.9037
114	T	A	-1.8093
115	E	A	-3.0804
116	G	A	-2.7596
117	D	A	-2.9249
118	G	A	-1.8382	mutated: WA118G
119	W	A	-0.9169
120	L	A	0.3372
121	A	A	0.0000
122	H	A	-0.3579
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4282
129	T	A	-0.4837
130	G	A	0.0000
131	Y	A	0.1987
132	I	A	0.0000
133	P	A	-0.7443
134	S	A	-1.4445
135	N	A	-1.3301
136	Y	A	-0.2485
137	V	A	0.0000
138	A	A	-0.0204
139	P	A	-0.1505
140	S	A	-0.1759