Project name: Valen&Jordi_1ozs_A

Chain sequence(s)	A: MKGKSEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Distance of aggregation	10 Å
Dynamic mode	No

• Minimal score value: -4.5515
• Maximal score value: 0.1976
• Average score: -2.0356
• Total score value: -148.5999

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
89	M	A	0.1166
90	K	A	-1.9751
91	G	A	-2.4658
92	K	A	-3.5677
93	S	A	-3.2758
94	E	A	-4.2460
95	E	A	-4.2338
96	E	A	-3.4329
97	L	A	0.0000
98	S	A	-2.8704
99	D	A	-3.1256
100	L	A	-1.5375
101	F	A	0.0000
102	R	A	-2.6151
103	M	A	-1.1722
104	F	A	0.0000
105	D	A	0.0000
106	K	A	-2.8898
107	N	A	-2.9992
108	A	A	-2.2177
109	D	A	-2.7806
110	G	A	-2.0842
111	Y	A	-2.1876
112	I	A	0.0000
113	D	A	-2.0955
114	L	A	-2.1656
115	E	A	-2.4371
116	E	A	0.0000
117	L	A	0.0000
118	K	A	-1.7526
119	I	A	-0.5213
120	M	A	0.0316
121	L	A	0.0000
122	Q	A	-1.5630
123	A	A	-0.8054
124	T	A	-1.0886
125	G	A	-1.8568
126	E	A	-2.3106
127	T	A	-1.4370
128	I	A	-1.6373
129	T	A	-2.5238
130	E	A	-3.5478
131	D	A	-3.6845
132	D	A	-3.3767
133	I	A	0.0000
134	E	A	-4.4040
135	E	A	-4.0917
136	L	A	-2.6716
137	M	A	0.0000
138	K	A	-4.5515
139	D	A	-3.9865
140	G	A	0.0000
141	D	A	-4.2787
142	K	A	-4.3903
143	N	A	-4.2546
144	N	A	-3.8966
145	D	A	-3.7239
146	G	A	-3.0542
147	R	A	-3.3340
148	I	A	0.0000
149	D	A	-2.6623
150	Y	A	-1.4052
151	D	A	-2.6045
152	E	A	-2.8017
153	F	A	0.0000
154	L	A	-1.9593
155	E	A	-2.4588
156	F	A	-1.0700
157	M	A	-0.6761
158	K	A	-1.7932
159	G	A	-0.9742
160	V	A	0.1976
161	E	A	-1.4222