Project name: SH3_Y131V

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	YA131V
Energy difference between WT (input) and mutated protein (by FoldX)	1.75429 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4774
• Maximal score value: 1.035
• Average score: -0.9229
• Total score value: -55.3753

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1047
87	V	A	-0.6192
88	A	A	0.0000
89	L	A	-0.2999
90	Y	A	-0.7095
91	D	A	-2.8409
92	Y	A	-2.1017
93	E	A	-2.8821
94	S	A	0.0000
95	R	A	-2.7824
96	T	A	-2.1681
97	E	A	-2.3670
98	T	A	-1.2513
99	D	A	-1.3451
100	L	A	0.0000
101	S	A	-1.9235
102	F	A	0.0000
103	K	A	-3.4774
104	K	A	-2.8504
105	G	A	-1.9568
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2857
110	I	A	0.3208
111	V	A	1.0350
112	N	A	-0.9027
113	N	A	-2.0408
114	T	A	-1.8635
115	E	A	-2.9980
116	G	A	-2.6555
117	D	A	-2.6881
118	W	A	-1.3851
119	W	A	-0.8030
120	L	A	0.3429
121	A	A	0.0000
122	H	A	-0.4217
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4110
129	T	A	-0.4844
130	G	A	0.0000
131	V	A	0.0928	mutated: YA131V
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2745
135	N	A	-1.2432
136	Y	A	-0.1971
137	V	A	0.0000
138	A	A	-0.0219
139	P	A	-0.1505
140	S	A	-0.1759