Project name: vibha kaushik

Status: done

submitted: 2019-03-15 14:03:31, status changed: 2019-03-15 16:26:07
Settings
Chain sequence(s) A: MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL
Distance of aggregation 5 Å
Dynamic mode Yes
Show buried residues

Minimal score value
-2.3308
Maximal score value
1.8404
Average score
-0.4118
Total score value
-68.3614

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.0642
2 A A 0.2153
3 S A -0.2832
4 G A -0.3844
5 V A 0.4052
6 A A 0.2258
7 V A 0.4207
8 S A -0.3313
9 D A -1.8323
10 G A -0.4518
11 V A 0.0000
12 I A 0.2583
13 K A -1.5595
14 V A -0.0462
15 F A 0.0000
16 N A -1.3259
17 D A -0.7851
18 M A 0.0000
19 K A -1.0514
20 V A 1.4445
21 R A -0.1721
22 K A -0.9834
23 S A -0.4102
24 S A -0.2616
25 T A -0.1498
26 P A -0.4835
27 E A -1.8556
28 E A -0.5916
29 V A 0.2014
30 K A -1.8994
31 K A -0.9100
32 R A 0.0000
33 K A -0.2160
34 K A 0.0000
35 A A 0.0000
36 V A 0.0000
37 L A 0.0000
38 F A 0.0000
39 C A 0.1517
40 L A 0.1731
41 S A -0.2600
42 E A -1.7540
43 D A -2.3308
44 K A -1.9187
45 K A -0.7304
46 N A -0.4865
47 I A 0.0000
48 I A 0.8387
49 L A 0.2702
50 E A -0.8321
51 E A -2.0124
52 G A -0.9055
53 K A -0.6582
54 E A -0.9414
55 I A 0.1390
56 L A 0.6036
57 V A 0.2344
58 G A -0.2618
59 D A -0.3277
60 V A 0.1454
61 G A -0.3400
62 Q A -1.2711
63 T A 0.0228
64 V A 1.5339
65 D A -0.7785
66 D A -0.6461
67 P A -0.1035
68 Y A 0.0000
69 A A 0.0077
70 T A -0.0112
71 F A 0.0000
72 V A 0.0000
73 K A -1.6635
74 M A -0.0603
75 L A 0.0000
76 P A -0.4678
77 D A -1.4449
78 K A -2.0366
79 D A -1.0872
80 C A 0.0000
81 R A -0.2754
82 Y A 0.0000
83 A A 0.0000
84 L A 0.0000
85 Y A 0.0000
86 D A 0.0000
87 A A 0.0000
88 T A 0.0000
89 Y A 0.0000
90 E A -1.3882
91 T A -0.5685
92 K A -2.0360
93 E A -2.1676
94 S A -0.8359
95 K A -2.1927
96 K A -2.1412
97 E A -0.9492
98 D A -0.4445
99 L A 0.0000
100 V A 0.0000
101 F A 0.0000
102 I A 0.0000
103 F A 0.0000
104 W A 0.0000
105 A A -0.1332
106 P A 0.0000
107 E A -1.8574
108 S A -0.5334
109 A A 0.0000
110 P A 0.1481
111 L A 1.1658
112 K A -1.4131
113 S A 0.0000
114 K A 0.0434
115 M A 1.0317
116 I A 0.4249
117 Y A 0.0000
118 A A 0.0233
119 S A -0.0920
120 S A 0.0000
121 K A -0.4833
122 D A -1.8170
123 A A -0.3069
124 I A 0.0000
125 K A -0.6920
126 K A -2.0925
127 K A -2.0214
128 L A 0.0000
129 T A -0.5974
130 G A -0.3816
131 I A 0.2931
132 K A -0.9745
133 H A -0.9604
134 E A -1.4193
135 L A 0.0000
136 Q A -0.9780
137 A A 0.0000
138 N A -1.1920
139 C A 0.4380
140 Y A 1.0528
141 E A -1.9289
142 E A -1.6037
143 V A 0.0000
144 K A -1.3929
145 D A -1.0342
146 R A -0.9555
147 C A 0.5464
148 T A -0.0785
149 L A 0.0000
150 A A -0.2531
151 E A -2.0635
152 K A -1.6109
153 L A 0.0000
154 G A -0.4133
155 G A -0.4988
156 S A -0.1551
157 A A 0.3644
158 V A 1.8404
159 I A 0.6296
160 S A -0.1453
161 L A 0.0000
162 E A -0.4420
163 G A -0.8261
164 K A -1.8300
165 P A -0.3628
166 L A 1.1345

Above is the comparison between the input structure and the most aggregation prone model (predicted in the flexibility simulations, download both models in the PDB file format , download table with rmsd values ). The picture presents the most aggregation prone model (in blue) superimposed on the input structure (in red). The plot shows rmsd profile (distances between residues of the superimposed structures).

Dynamic mode uses CABS-flex simulations of protein structure fluctuations. The structure fluctuations may have impact on the size and extent of aggregation "hot-spots" on the protein surface. The dynamic mode uses the following pipeline: (1) based on the input structure, CABS-flex predicts a set of different models reflecting protein dynamics in solution; (2) for each of these models A3D score is calculated; (3) finally, the most aggregation prone model (the model with the highest A3D score, -0.4118 in this case) is selected and presented in A3D results.


 

Laboratory of Theory of Biopolymers 2015