Project name: SH3_L120Y

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	LA120Y
Energy difference between WT (input) and mutated protein (by FoldX)	1.63363 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.3169
• Average score: -0.8835
• Total score value: -53.0126

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4553
82	S	A	-0.6883
83	H	A	-0.7953
84	M	A	0.2594
85	T	A	0.0000
86	F	A	-0.1138
87	V	A	-0.6272
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1605
97	E	A	-2.3591
98	T	A	-1.2393
99	D	A	-1.3271
100	L	A	0.0000
101	S	A	-1.9068
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0798
108	L	A	0.0000
109	Q	A	-0.2619
110	I	A	0.4667
111	V	A	1.3169
112	N	A	-0.2890
113	N	A	-1.7441
114	T	A	-1.6880
115	E	A	-2.9056
116	G	A	-2.5975
117	D	A	-2.6907
118	W	A	-1.3227
119	W	A	-0.6392
120	Y	A	0.5124	mutated: LA120Y
121	A	A	0.0000
122	H	A	-0.3679
123	S	A	0.0000
124	L	A	-0.2622
125	T	A	-0.7643
126	T	A	-0.8481
127	G	A	-0.7586
128	Q	A	-1.3748
129	T	A	-0.4560
130	G	A	0.0000
131	Y	A	0.2211
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2819
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1544
140	S	A	-0.1759