Project name: SH3_N135I

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	NA135I
Energy difference between WT (input) and mutated protein (by FoldX)	-0.249022 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4902
• Maximal score value: 2.0218
• Average score: -0.7366
• Total score value: -44.1959

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1080
87	V	A	-0.6302
88	A	A	0.0000
89	L	A	0.1513
90	Y	A	-0.3985
91	D	A	-2.8698
92	Y	A	-2.1175
93	E	A	-2.8821
94	S	A	0.0000
95	R	A	-2.7838
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3230
100	L	A	0.0000
101	S	A	-1.9038
102	F	A	0.0000
103	K	A	-3.4902
104	K	A	-2.8765
105	G	A	-1.9668
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4378
111	V	A	1.2498
112	N	A	-0.4200
113	N	A	-1.8135
114	T	A	-1.7328
115	E	A	-2.9356
116	G	A	-2.2438
117	D	A	-2.0907
118	W	A	-0.8866
119	W	A	-0.3554
120	L	A	0.4053
121	A	A	0.0000
122	H	A	-0.3840
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4950
130	G	A	0.0000
131	Y	A	0.2204
132	I	A	0.0000
133	P	A	0.0000
134	S	A	0.3166
135	I	A	2.0218	mutated: NA135I
136	Y	A	1.3451
137	V	A	0.0000
138	A	A	0.5832
139	P	A	-0.1505
140	S	A	-0.1759