Project name: SH3_L89V

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	LA89V
Energy difference between WT (input) and mutated protein (by FoldX)	1.22791 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4829
• Maximal score value: 1.2558
• Average score: -0.8891
• Total score value: -53.349

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4506
82	S	A	-0.6820
83	H	A	-0.7908
84	M	A	0.2676
85	T	A	0.0000
86	F	A	-0.0481
87	V	A	-0.5189
88	A	A	0.0000
89	V	A	-0.2880	mutated: LA89V
90	Y	A	-0.7679
91	D	A	-2.8738
92	Y	A	-2.1137
93	E	A	-2.8802
94	S	A	0.0000
95	R	A	-2.7834
96	T	A	-2.1546
97	E	A	-2.3532
98	T	A	-1.2427
99	D	A	-1.3248
100	L	A	0.0000
101	S	A	-1.9033
102	F	A	0.0000
103	K	A	-3.4829
104	K	A	-2.8571
105	G	A	-1.9357
106	E	A	0.0000
107	R	A	-2.0342
108	L	A	0.0000
109	Q	A	-0.2308
110	I	A	0.4416
111	V	A	1.2558
112	N	A	-0.4087
113	N	A	-1.8092
114	T	A	-1.7294
115	E	A	-2.9343
116	G	A	-2.6073
117	D	A	-2.6850
118	W	A	-1.3420
119	W	A	-0.6960
120	L	A	0.4072
121	A	A	0.0000
122	H	A	-0.3823
123	S	A	0.0000
124	L	A	-0.2789
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4956
130	G	A	0.0000
131	Y	A	0.2160
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2841
135	N	A	-1.2485
136	Y	A	-0.1919
137	V	A	0.0000
138	A	A	0.0233
139	P	A	-0.1194
140	S	A	-0.1441