Project name: SH3_I110F

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	IA110F
Energy difference between WT (input) and mutated protein (by FoldX)	2.98888 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.3754
• Average score: -0.9148
• Total score value: -54.8896

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.5315
82	S	A	-0.8041
83	H	A	-1.0348
84	M	A	-0.2434
85	T	A	0.0000
86	F	A	0.0000
87	V	A	-0.7219
88	A	A	0.0000
89	L	A	-0.3370
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1057
93	E	A	-2.8817
94	S	A	0.0000
95	R	A	-2.7840
96	T	A	-2.1637
97	E	A	-2.3623
98	T	A	-1.2597
99	D	A	-1.3598
100	L	A	0.0000
101	S	A	-1.9153
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9867
106	E	A	0.0000
107	R	A	-2.1068
108	L	A	0.0000
109	Q	A	-0.2820
110	F	A	0.5554	mutated: IA110F
111	V	A	1.3754
112	N	A	-0.3278
113	N	A	-1.7577
114	T	A	-1.7243
115	E	A	-2.9371
116	G	A	-2.6159
117	D	A	-2.7114
118	W	A	-1.3916
119	W	A	-0.6702
120	L	A	0.4638
121	A	A	0.0000
122	H	A	-0.3300
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4120
129	T	A	-0.4822
130	G	A	0.0000
131	Y	A	0.1691
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2802
135	N	A	-1.2534
136	Y	A	-0.2292
137	V	A	0.0000
138	A	A	-0.0881
139	P	A	-0.3181
140	S	A	-0.3540