Project name: SH3_Y92G

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	YA92G
Energy difference between WT (input) and mutated protein (by FoldX)	5.31061 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.5686
• Maximal score value: 1.2501
• Average score: -0.962
• Total score value: -57.7225

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.0952
87	V	A	-0.6086
88	A	A	0.0000
89	L	A	-0.3196
90	Y	A	-0.7865
91	D	A	-3.0014
92	G	A	-2.4620	mutated: YA92G
93	E	A	-3.0885
94	S	A	-2.3329
95	R	A	-2.8639
96	T	A	-2.2108
97	E	A	-2.4009
98	T	A	-1.3185
99	D	A	-1.5113
100	L	A	0.0000
101	S	A	-2.0648
102	F	A	0.0000
103	K	A	-3.5686
104	K	A	-2.9012
105	G	A	-1.9605
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4375
111	V	A	1.2501
112	N	A	-0.4038
113	N	A	-1.7901
114	T	A	-1.7162
115	E	A	-2.9036
116	G	A	-2.5795
117	D	A	-2.6357
118	W	A	-1.2447
119	W	A	-0.6639
120	L	A	0.4046
121	A	A	0.0000
122	H	A	-0.3837
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8786
127	G	A	-0.8169
128	Q	A	-1.4280
129	T	A	-0.5216
130	G	A	0.0000
131	Y	A	0.1795
132	I	A	0.0000
133	P	A	-0.5629
134	S	A	-1.2359
135	N	A	-1.1996
136	Y	A	-0.1657
137	V	A	0.0000
138	A	A	-0.0038
139	P	A	-0.1505
140	S	A	-0.1759