Project name: SH3_S134L

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	SA134L
Energy difference between WT (input) and mutated protein (by FoldX)	1.40904 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.475
• Maximal score value: 1.2488
• Average score: -0.877
• Total score value: -52.6219

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4503
82	S	A	-0.6820
83	H	A	-0.7912
84	M	A	0.2690
85	T	A	0.0000
86	F	A	-0.0879
87	V	A	-0.6026
88	A	A	0.0000
89	L	A	-0.2676
90	Y	A	-0.6789
91	D	A	-2.8228
92	Y	A	-2.0876
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3285
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4750
104	K	A	-2.8354
105	G	A	-1.9550
106	E	A	0.0000
107	R	A	-2.0690
108	L	A	0.0000
109	Q	A	-0.2448
110	I	A	0.4743
111	V	A	1.2488
112	N	A	-0.4242
113	N	A	-1.7759
114	T	A	-1.7364
115	E	A	-2.9030
116	G	A	-2.5487
117	D	A	-2.5949
118	W	A	-1.2510
119	W	A	-0.6342
120	L	A	0.4319
121	A	A	0.0000
122	H	A	-0.3847
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4944
130	G	A	0.0000
131	Y	A	0.2503
132	I	A	0.0000
133	P	A	-0.3866
134	L	A	-0.9550	mutated: SA134L
135	N	A	-1.0577
136	Y	A	-0.0149
137	V	A	0.0000
138	A	A	0.0479
139	P	A	-0.1471
140	S	A	-0.1735