Project name: 2m3o DI1000193

Status: done

submitted: 2018-11-28 12:24:14, status changed: 2018-11-28 12:27:01
Settings
Chain sequence(s) P: TAPPPAYATLG
W: GSMEQGFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPA
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-2.6733
Maximal score value
1.1599
Average score
-0.7833
Total score value
-42.2956

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
416 G W -0.4580
417 S W -0.6617
418 M W -0.5934
419 E W -1.7743
420 Q W -1.0608
421 G W -0.2419
422 F W 1.0806
423 L W 0.1462
424 P W -0.6108
425 K W -1.8024
426 G W -1.6875
427 W W -0.8798
428 E W -0.8399
429 V W -0.5862
430 R W -1.9455
431 H W -2.3670
432 A W 0.0000
433 P W -1.7008
434 N W -2.2666
435 G W -2.3447
436 R W -2.6733
437 P W -2.0771
438 F W 0.0000
439 F W 0.0000
440 I W 0.0000
441 D W 0.0000
442 H W -1.8524
443 N W -2.1744
444 T W -1.5838
445 K W -2.0898
446 T W -1.0891
447 T W -0.7693
448 T W -0.5164
449 W W -0.9171
450 E W -1.9422
451 D W -1.4940
452 P W -0.6995
453 R W -0.7499
454 L W -0.2044
455 K W -0.7155
456 I W 1.1599
457 P W 0.3688
458 A W 0.2750
638 T P -0.1023
639 A P -0.2889
640 P P -0.2403
641 P P -0.6778
642 P P -0.2573
643 A P -0.1547
644 Y P -0.1818
645 A P -0.0728
646 T P 0.1167
647 L P 0.0867
648 G P -0.1841

 

Laboratory of Theory of Biopolymers 2015