Project name: SH3_E115W

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	EA115W
Energy difference between WT (input) and mutated protein (by FoldX)	-0.420809 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.3025
• Average score: -0.7454
• Total score value: -44.7255

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1044
87	V	A	-0.6223
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1773
97	E	A	-2.3761
98	T	A	-1.2966
99	D	A	-1.4170
100	L	A	0.0000
101	S	A	-1.9326
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2299
110	I	A	0.4575
111	V	A	1.3025
112	N	A	0.1647
113	N	A	-0.8693
114	T	A	-0.4016
115	W	A	-0.2599	mutated: EA115W
116	G	A	-1.3072
117	D	A	-1.9588
118	W	A	-0.6806
119	W	A	-0.0946
120	L	A	0.6881
121	A	A	0.0000
122	H	A	-0.3969
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.5374
130	G	A	0.0000
131	Y	A	0.0196
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.0118
135	N	A	-1.2527
136	Y	A	-0.2070
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1505
140	S	A	-0.1759