Project name: 12_w [mutate: DA169G]

Chain sequence(s)	A: KTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQ
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	DA169G
Energy difference between WT (input) and mutated protein (by FoldX)	-0.779525 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.5408
• Maximal score value: 0.6707
• Average score: -1.0861
• Total score value: -182.4628

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
102	K	A	-2.6141
103	T	A	-1.7211
104	S	A	0.0000
105	D	A	0.0000
106	L	A	0.0000
107	I	A	0.0000
108	V	A	0.0000
109	L	A	0.0000
110	G	A	0.0000
111	L	A	0.0000
112	P	A	-0.4386
113	W	A	-0.3566
114	K	A	-1.5317
115	T	A	-1.3405
116	T	A	-1.3012
117	E	A	-1.8936
118	Q	A	-2.4831
119	D	A	-2.4097
120	L	A	0.0000
121	K	A	-2.3603
122	E	A	-2.7466
123	Y	A	-1.1980
124	F	A	0.0000
125	S	A	-1.1473
126	T	A	-0.5939
127	F	A	-0.4419
128	G	A	-1.2618
129	E	A	-1.8180
130	V	A	0.0000
131	L	A	0.6707
132	M	A	0.0000
133	V	A	0.0000
134	Q	A	-0.7127
135	V	A	-0.5638
136	K	A	-0.8463
137	K	A	-1.5347
138	D	A	-1.1531
139	L	A	-0.2053
140	K	A	-1.4277
141	T	A	-1.2174
142	G	A	-1.1520
143	H	A	-1.7323
144	S	A	-1.2460
145	K	A	-1.1047
146	G	A	0.0000
147	F	A	0.0000
148	G	A	0.0000
149	F	A	0.0000
150	V	A	0.0000
151	R	A	-0.2577
152	F	A	0.0000
153	T	A	-1.1997
154	E	A	-2.4641
155	Y	A	-1.7676
156	E	A	-2.1753
157	T	A	0.0000
158	Q	A	0.0000
159	V	A	-0.7295
160	K	A	-1.0239
161	V	A	0.0000
162	M	A	-0.8441
163	S	A	-1.2087
164	Q	A	-2.2125
165	R	A	-2.1150
166	H	A	0.0000
167	M	A	0.1130
168	I	A	0.0000
169	G	A	-1.0316	mutated: DA169G
170	G	A	-0.7703
171	R	A	-0.6569
172	W	A	0.2731
173	C	A	0.0000
174	D	A	-0.9024
175	C	A	0.0000
176	K	A	-1.2539
177	L	A	-0.5645
178	P	A	0.0000
179	N	A	-1.5632
180	S	A	-1.0898
181	K	A	0.0000
182	Q	A	-2.0021
183	S	A	-1.8725
184	Q	A	-2.8518
185	D	A	-3.4851
186	E	A	-2.8168
187	P	A	-1.3814
188	L	A	-0.3245
189	R	A	-2.4814
190	S	A	-3.0756
191	R	A	-2.8269
192	K	A	-2.1454
193	V	A	0.0000
194	F	A	-0.2085
195	V	A	0.0000
196	G	A	0.0000
197	R	A	-0.4130
198	C	A	0.0000
199	T	A	-1.4059
200	E	A	-2.5271
201	D	A	-3.0291
202	M	A	0.0000
203	T	A	-1.9051
204	E	A	-2.0250
205	D	A	-3.2482
206	E	A	-3.0355
207	L	A	0.0000
208	R	A	-3.0567
209	E	A	-3.2680
210	F	A	-1.8761
211	F	A	0.0000
212	S	A	-1.6230
213	Q	A	-1.6852
214	Y	A	-0.4521
215	G	A	-1.2935
216	D	A	-1.9551
217	V	A	0.0000
218	M	A	-0.7398
219	D	A	-1.8460
220	V	A	-1.1802
221	F	A	-0.0406
222	I	A	0.0000
223	P	A	0.0000
224	K	A	-1.7006
225	P	A	-1.3880
226	F	A	-0.9152
227	R	A	-0.8763
228	A	A	0.0000
229	F	A	0.0000
230	A	A	0.0000
231	F	A	0.0000
232	V	A	0.0000
233	T	A	-1.2225
234	F	A	0.0000
235	A	A	-1.5708
236	D	A	-2.4934
237	D	A	-3.5408
238	Q	A	-2.9000
239	I	A	-1.9046
240	A	A	0.0000
241	Q	A	-2.2859
242	S	A	-1.4186
243	L	A	0.0000
244	C	A	0.0000
245	G	A	-1.8714
246	E	A	-2.0929
247	D	A	0.0000
248	L	A	0.0000
249	I	A	-0.1839
250	I	A	0.0000
251	K	A	-2.0210
252	G	A	-0.9175
253	I	A	0.0000
254	S	A	0.0000
255	V	A	0.0000
256	H	A	-0.5033
257	I	A	0.0000
258	S	A	-0.7012
259	N	A	-1.2996
260	A	A	0.0000
261	E	A	-2.7456
262	P	A	-2.5716
263	K	A	-2.5481
264	H	A	-2.3810
265	N	A	-2.9444
266	S	A	-2.7235
267	N	A	-3.2969
268	R	A	-3.3619
269	Q	A	-2.6772