Project name: e60f27ad7922a5d [mutate: PA74S]

Chain sequence(s)	A: MSGAPSATQPATAETQHIADQVRSQLEEKYNKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKSLTLSNYQTNKAKHDELTYF
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	PA74S
Energy difference between WT (input) and mutated protein (by FoldX)	2.44819 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -4.0825
• Maximal score value: 1.9056
• Average score: -0.6456
• Total score value: -62.6199

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
2	M	A	0.8467
3	S	A	0.2534
4	G	A	0.1678
5	A	A	-0.3641
6	P	A	-0.9103
7	S	A	-0.9735
8	A	A	-0.7525
9	T	A	-0.9009
10	Q	A	-0.7601
11	P	A	-0.1987
12	A	A	-0.3337
13	T	A	-0.4300
14	A	A	-0.9022
15	E	A	-1.9131
16	T	A	-0.7572
17	Q	A	-1.3396
18	H	A	-1.7373
19	I	A	0.2164
20	A	A	-0.7315
21	D	A	-2.3738
22	Q	A	-1.4814
23	V	A	-0.1976
24	R	A	-1.3787
25	S	A	-2.2510
26	Q	A	-1.8804
27	L	A	-1.5538
28	E	A	0.0000
29	E	A	-3.7133
30	K	A	-2.9082
31	Y	A	-1.5049
32	N	A	-2.8653
33	K	A	-3.3363
34	K	A	-2.7122
35	F	A	-0.4374
36	P	A	-0.0157
37	V	A	1.2578
38	F	A	0.0193
39	K	A	-0.9772
40	A	A	-0.0060
41	V	A	1.2433
42	S	A	0.1194
43	F	A	-0.3806
44	K	A	-2.1109
45	S	A	-1.3118
46	Q	A	-0.9171
47	V	A	1.0874
48	V	A	1.8281
49	A	A	1.0233
50	G	A	0.3946
51	T	A	0.2368
52	N	A	0.3343
53	Y	A	1.3260
54	F	A	1.3799
55	I	A	1.4279
56	K	A	-0.0693
57	V	A	0.1457
58	H	A	-1.4094
59	V	A	-0.2154
60	G	A	-1.4839
61	D	A	-3.1288
62	E	A	-4.0825
63	D	A	-3.6782
64	F	A	0.0000
65	V	A	-0.3703
66	H	A	0.0000
67	L	A	1.3817
68	R	A	1.1591
69	V	A	1.4135
70	F	A	0.8955
71	Q	A	0.1208
72	S	A	0.0285
73	L	A	0.3127
74	S	A	-0.8401	mutated: PA74S
75	H	A	-1.9820
76	E	A	-2.7394
77	N	A	-2.0264
78	K	A	-2.2496
79	S	A	-0.7006
80	L	A	0.8519
81	T	A	1.0910
82	L	A	1.9056
83	S	A	0.9544
84	N	A	0.5583
85	Y	A	1.2379
86	Q	A	-0.4088
87	T	A	-0.7463
88	N	A	-2.1277
89	K	A	-2.6700
90	A	A	-3.0438
91	K	A	-3.5247
92	H	A	-2.4959
93	D	A	-2.2786
94	E	A	-2.0288
95	L	A	0.3487
96	T	A	0.5558
97	Y	A	1.5538
98	F	A	1.3216