Project name: SH3_T129N

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	TA129N
Energy difference between WT (input) and mutated protein (by FoldX)	1.00955 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.0616
• Average score: -0.9834
• Total score value: -59.0034

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4535
82	S	A	-0.6860
83	H	A	-0.7937
84	M	A	0.2624
85	T	A	0.0000
86	F	A	-0.1100
87	V	A	-0.6252
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1549
97	E	A	-2.3535
98	T	A	-1.4370
99	D	A	-1.5439
100	L	A	0.0000
101	S	A	-2.0780
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.1039
108	L	A	0.0000
109	Q	A	-0.4650
110	I	A	0.2648
111	V	A	1.0616
112	N	A	-0.4330
113	N	A	-1.8149
114	T	A	-1.7321
115	E	A	-2.9375
116	G	A	-2.6068
117	D	A	-2.6853
118	W	A	-1.3500
119	W	A	-0.7252
120	L	A	0.1069
121	A	A	0.0000
122	H	A	-1.0490
123	S	A	0.0000
124	L	A	-0.5125
125	T	A	-0.8221
126	T	A	-1.0906
127	G	A	-1.1685
128	Q	A	-2.0601
129	N	A	-1.7742	mutated: TA129N
130	G	A	0.0000
131	Y	A	-0.0594
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2908
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1528
140	S	A	-0.1759