Project name: 9c0c195a3f24d66

Status: done

submitted: 2019-01-29 14:05:16, status changed: 2019-01-29 14:12:11
Settings
Chain sequence(s) X: EVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYADLLAKVNGEYTADLEDGGNHMNIKFA
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-3.3736
Maximal score value
0.8216
Average score
-1.1203
Total score value
-67.2207

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
820 E X -1.9651
821 V X -1.2288
822 T X -1.3765
823 I X 0.0000
824 K X -2.4473
825 V X 0.0000
826 N X -0.7923
827 L X 0.0000
828 I X -0.1392
829 F X -0.6809
830 A X -1.0307
831 D X -2.1090
832 G X -1.5157
833 K X -1.5407
834 I X 0.3418
835 Q X -0.5208
836 T X -0.8147
837 A X -1.4216
838 E X -2.4974
839 F X -2.0922
840 K X -2.9941
841 G X -2.1039
842 T X -1.2879
843 F X -0.2049
844 E X -2.2429
845 E X -3.1499
846 A X 0.0000
847 T X -2.0191
848 A X -2.0364
849 E X -3.3736
850 A X 0.0000
851 Y X -0.9530
852 R X -2.1244
853 Y X -0.6154
854 A X 0.0000
855 D X -1.5345
856 L X 0.6233
857 L X 0.1771
858 A X -0.8140
859 K X -1.0246
860 V X 0.8216
861 N X -0.4201
862 G X -1.2355
863 E X -2.0806
864 Y X -0.8422
865 T X -0.6622
866 A X -0.2310
867 D X -0.6456
868 L X -0.3307
869 E X -2.4419
870 D X -2.8717
871 G X -1.7672
872 G X -1.2732
873 N X -1.4799
874 H X -2.0905
875 M X 0.0000
876 N X -0.7475
877 I X 0.0000
878 K X -0.8184
879 F X -0.5948

 

Laboratory of Theory of Biopolymers 2015