Project name: SH3_R107E

Status: done

submitted: 2019-03-14 15:23:10, status changed: 2019-03-14 16:54:36
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues RA107E
Energy difference between WT (input) and mutated protein (by FoldX) 0.859173 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4801
Maximal score value
1.2377
Average score
-0.8937
Total score value
-53.6204

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4540
82 S A -0.6869
83 H A -0.7960
84 M A 0.2561
85 T A -0.2453
86 F A -0.1150
87 V A -0.6320
88 A A 0.0000
89 L A -0.3160
90 Y A -0.7383
91 D A -2.8528
92 Y A -2.1055
93 E A -2.8815
94 S A 0.0000
95 R A -2.7837
96 T A -2.1540
97 E A -2.3526
98 T A -1.2408
99 D A -1.3222
100 L A 0.0000
101 S A -1.9032
102 F A 0.0000
103 K A -3.4801
104 K A -2.8610
105 G A -1.9571
106 E A 0.0000
107 E A -2.0144 mutated: RA107E
108 L A 0.0000
109 Q A -0.2455
110 I A 0.4211
111 V A 1.2377
112 N A -0.4254
113 N A -1.8138
114 T A -1.7326
115 E A -2.9361
116 G A -2.6085
117 D A -2.6844
118 W A -1.3421
119 W A -0.7020
120 L A 0.3957
121 A A 0.0000
122 H A -0.3870
123 S A 0.0000
124 L A -0.1293
125 T A -0.6824
126 T A -0.8206
127 G A -0.7580
128 Q A -1.3869
129 T A -0.4915
130 G A 0.0000
131 Y A 0.2142
132 I A 0.0000
133 P A 0.0000
134 S A -1.2855
135 N A -1.2485
136 Y A -0.2059
137 V A 0.0000
138 A A -0.0280
139 P A -0.1572
140 S A -0.1816

 

Laboratory of Theory of Biopolymers 2015