Project name: SH3_W119E

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	WA119E
Energy difference between WT (input) and mutated protein (by FoldX)	3.80095 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.1768
• Average score: -0.9226
• Total score value: -55.3574

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4512
82	S	A	-0.6828
83	H	A	-0.7912
84	M	A	0.2801
85	T	A	0.0000
86	F	A	-0.0431
87	V	A	-0.5920
88	A	A	0.0000
89	L	A	-0.3050
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3644
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9546
106	E	A	0.0000
107	R	A	-2.0539
108	L	A	0.0000
109	Q	A	-0.2343
110	I	A	0.3615
111	V	A	1.1768
112	N	A	-0.5332
113	N	A	-1.9567
114	T	A	-1.8032
115	E	A	-3.0273
116	G	A	-2.6885
117	D	A	-2.7753
118	W	A	-1.5291
119	E	A	-1.0711	mutated: WA119E
120	L	A	0.2215
121	A	A	0.0000
122	H	A	-0.4232
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4951
130	G	A	0.0000
131	Y	A	0.0928
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.4082
135	N	A	-1.2975
136	Y	A	-0.2045
137	V	A	0.0000
138	A	A	-0.0043
139	P	A	-0.1233
140	S	A	-0.1534