Project name: 9cb5f056d40df7f

Chain sequence(s)	A: FNTSDYRFECICGELDQIDRKPRVQCLKCHLWQHAKCVNYDEKNLKIKPFYCPHCLVAMEPVSTR
Distance of aggregation	10 Å
Dynamic mode	No

• Minimal score value: -2.8451
• Maximal score value: 1.7754
• Average score: -0.6793
• Total score value: -44.1562

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
652	F	A	1.1041
653	N	A	-0.8645
654	T	A	-0.5753
655	S	A	-1.1112
656	D	A	-1.8364
657	Y	A	-0.6184
658	R	A	-1.9495
659	F	A	-0.9567
660	E	A	-1.6013
661	C	A	0.0000
662	I	A	1.7096
663	C	A	0.7063
664	G	A	-0.7169
665	E	A	-1.7717
666	L	A	-1.2033
667	D	A	-1.8227
668	Q	A	-1.7604
669	I	A	-1.0394
670	D	A	-2.5741
671	R	A	-2.8451
672	K	A	-2.5716
673	P	A	0.0000
674	R	A	-1.7882
675	V	A	0.0000
676	Q	A	-0.9401
677	C	A	0.0000
678	L	A	0.3598
679	K	A	-1.0750
680	C	A	-0.4192
681	H	A	-0.9071
682	L	A	-0.6244
683	W	A	-0.6073
684	Q	A	0.0000
685	H	A	0.0000
686	A	A	0.0000
687	K	A	-2.4355
688	C	A	-0.6590
689	V	A	-0.7275
690	N	A	-1.7192
691	Y	A	-1.4977
692	D	A	-2.4324
693	E	A	-2.1077
694	K	A	-2.4543
695	N	A	-1.5496
696	L	A	-1.6055
697	K	A	-1.7356
698	I	A	0.0701
699	K	A	-1.3044
700	P	A	-0.4620
701	F	A	-0.2445
702	Y	A	0.2415
703	C	A	0.0000
704	P	A	0.2146
705	H	A	-0.0359
706	C	A	0.3930
707	L	A	1.3964
708	V	A	1.7754
709	A	A	1.0567
710	M	A	1.0458
711	E	A	-0.3022
712	P	A	0.2330
713	V	A	1.2537
714	S	A	-0.0016
715	T	A	-0.5809
716	R	A	-1.6809