Project name: CH2 A3D [mutate: FA241A, FA243K]

Status: done

submitted: 2018-11-18 10:10:01, status changed: 2018-11-18 10:14:32
Settings
Chain sequence(s) A: GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQ
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues FA241A, FA243K
Energy difference between WT (input) and mutated protein (by FoldX) 2.12912 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4944
Maximal score value
1.8177
Average score
-1.1355
Total score value
-121.4987

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
236 G A -0.8173
237 G A -0.8381
238 P A 0.0000
239 S A -0.4968
240 V A 0.0000
241 A A -0.6108 mutated: FA241A
242 L A 0.0000
243 K A -1.6922 mutated: FA243K
244 P A -1.8246
245 P A 0.0000
246 K A -2.6657
247 P A -1.5768
248 K A -1.6650
249 D A 0.0000
250 T A 0.0000
251 L A 1.0894
252 M A 1.1315
253 I A 1.8177
254 S A 0.2677
255 R A -1.3465
256 T A -0.7379
257 P A 0.0000
258 E A -1.3558
259 V A 0.0000
260 T A -0.7488
261 C A 0.0000
262 V A 0.0000
263 V A 0.0000
264 V A -0.4417
265 D A -1.3910
266 V A 0.0000
267 S A -2.1214
268 H A -2.2538
269 E A -2.8808
270 D A -2.6281
271 P A -2.4393
272 E A -3.0464
273 V A -1.9436
274 K A -2.2497
275 F A -1.2987
276 N A -1.4679
277 W A 0.0000
278 Y A -0.9098
279 V A -0.9566
280 D A -1.9563
281 G A -0.9064
282 V A 0.3523
283 E A -1.2378
284 V A -0.6698
285 H A -1.7594
286 N A -1.6613
287 A A -1.6002
288 K A -2.3132
289 T A -1.9888
290 K A -2.6101
291 P A -2.4286
292 R A -3.3540
293 E A -3.4944
294 E A -3.0004
295 Q A -1.5975
296 Y A 0.1584
297 N A -0.7811
298 S A -1.1758
299 T A -1.7947
300 Y A -2.2895
301 R A -2.1936
302 V A 0.0000
303 V A 0.0000
304 S A 0.0000
305 V A -1.0378
306 L A 0.0000
307 T A -0.4654
308 V A 0.0000
309 L A 1.0189
310 H A 0.5003
311 Q A -0.5316
312 D A -1.2991
313 W A 0.0000
314 L A -0.5332
315 N A -1.8670
316 G A -2.3342
317 K A -2.3535
318 E A -2.7016
319 Y A 0.0000
320 K A -1.8018
321 C A 0.0000
322 K A -1.8044
323 V A 0.0000
324 S A -1.5177
325 N A 0.0000
326 K A -2.5631
327 A A -1.4094
328 L A -0.6484
329 P A -0.4350
330 A A -0.4353
331 P A -0.9803
332 I A -0.8294
333 E A -2.2436
334 K A -1.9639
335 T A -2.0107
336 I A 0.0000
337 S A -2.7311
338 K A -2.8519
339 A A -1.9935
340 K A -2.6748
341 G A -2.4739
342 Q A -2.1253

 

Laboratory of Theory of Biopolymers 2015