Project name: 9e82bc14d20916d [mutate: RA261Q]

Status: done

submitted: 2019-01-15 22:11:13, status changed: 2019-01-16 00:51:41
Settings
Chain sequence(s) A: TVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQRIEVLD
Distance of aggregation 10 Å
Dynamic mode Yes
Mutated residues RA261Q
Energy difference between WT (input) and mutated protein (by FoldX) 1.73605 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.8601
Maximal score value
1.4861
Average score
-0.7052
Total score value
-217.9184

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
117 T A 0.1475
118 V A 0.5359
119 P A 0.2373
120 W A 0.1960
121 F A 0.0130
122 P A 0.0000
123 R A -2.0689
124 T A -1.9775
125 I A 0.0000
126 Q A -2.2943
127 E A -2.3644
128 L A 0.0000
129 D A 0.0000
130 R A -2.4571
131 F A -0.9180
132 A A 0.0000
133 N A -1.8939
134 Q A -1.3831
135 I A 0.2916
136 L A 1.4861
137 S A 0.7016
138 Y A 0.3480
139 G A -0.6667
140 A A 0.0000
141 E A -1.7596
142 L A -0.5192
143 D A -1.6834
144 A A -1.0327
145 D A -1.4010
146 H A -1.7288
147 P A -1.6089
148 G A -1.8012
149 F A -2.1549
150 K A -2.3614
151 D A -1.9170
152 P A -0.8494
153 V A 0.0783
154 Y A 0.0000
155 R A -2.7443
156 A A -1.7207
157 R A -2.1639
158 R A -2.3934
159 K A -3.1499
160 Q A -2.7287
161 F A -1.6214
162 A A -1.4653
163 D A -1.9212
164 I A -0.8202
165 A A -0.7847
166 Y A -0.4634
167 N A -1.2107
168 Y A -1.1588
169 R A -1.7670
170 H A -1.9425
171 G A -1.6343
172 Q A -1.8416
173 P A -1.1779
174 I A 0.0000
175 P A -1.1971
176 R A -1.8244
177 V A -0.2917
178 E A -1.9983
179 Y A -0.9580
180 M A -1.7181
181 E A -3.3802
182 E A -2.8776
183 E A 0.0000
184 K A -3.2965
185 K A -3.1607
186 T A -1.6582
187 W A 0.0000
188 G A 0.0000
189 T A -1.1881
190 V A -0.3397
191 F A 0.0000
192 K A -2.3262
193 T A -1.2666
194 L A 0.0000
195 K A -2.4587
196 S A -1.8573
197 L A 0.0000
198 Y A 0.0000
199 K A -2.0861
200 T A -1.2105
201 H A -0.5148
202 A A -0.3502
203 C A 0.0000
204 Y A 0.2149
205 E A -0.7282
206 Y A 0.0000
207 N A -0.7708
208 H A -0.6342
209 I A 0.1174
210 F A 0.1181
211 P A -0.0452
212 L A 1.0979
213 L A 0.0000
214 E A -0.6824
215 K A -1.2539
216 Y A 0.1940
217 C A 0.0000
218 G A 0.0000
219 F A 0.0000
220 H A -2.9209
221 E A -3.8158
222 D A -3.8601
223 N A -2.9982
224 I A 0.0000
225 P A 0.0000
226 Q A -1.3027
227 L A -0.6809
228 E A -1.3225
229 D A -1.1227
230 V A 0.0000
231 S A 0.0000
232 Q A -1.6710
233 F A 0.0000
234 L A 0.0000
235 Q A -1.8829
236 T A -0.9498
237 C A -0.7556
238 T A -0.9372
239 G A -1.2277
240 F A 0.0000
241 R A -1.2972
242 L A -0.6768
243 R A 0.0000
244 P A 0.0273
245 V A 0.0000
246 A A 0.0810
247 G A 0.4203
248 L A 0.6624
249 L A 0.5826
250 S A 0.0974
251 S A 0.0000
252 R A -0.5675
253 D A 0.0000
254 F A 0.0000
255 L A 0.0000
256 G A 0.0000
257 G A 0.0000
258 L A 0.0000
259 A A 0.0000
260 F A 0.0000
261 Q A -0.6521 mutated: RA261Q
262 V A 0.0000
263 F A 0.0000
264 H A 0.0000
265 C A 0.1285
266 T A 0.0000
267 Q A 0.0000
268 Y A -0.0500
269 I A 0.0000
270 R A -0.6681
271 H A -1.3456
272 G A -1.3225
273 S A -1.1154
274 K A -1.6667
275 P A -0.3169
276 M A 0.8038
277 Y A 0.5487
278 T A 0.1373
279 P A -0.4260
280 E A -0.1584
281 P A 0.0000
282 D A -0.2101
283 I A 0.1397
284 C A 0.1620
285 H A 0.0000
286 E A 0.0000
287 L A 0.0000
288 L A 0.0000
289 G A 0.0000
290 H A -0.1457
291 V A 0.0000
292 P A 0.0000
293 L A 0.0000
294 F A 0.0000
295 S A 0.0000
296 D A -0.8049
297 R A -1.0577
298 S A -0.6925
299 F A 0.0000
300 A A 0.0000
301 Q A -0.8825
302 F A -0.7067
303 S A 0.0000
304 Q A -0.5853
305 E A -0.8515
306 I A 0.0000
307 G A 0.0000
308 L A 0.2375
309 A A 0.0535
310 S A 0.0000
311 L A 0.0000
312 G A 0.0000
313 A A 0.0000
314 P A -0.7786
315 D A -1.6626
316 E A -2.2936
317 Y A -0.9032
318 I A 0.0000
319 E A -2.0173
320 K A -1.5027
321 L A 0.0000
322 A A 0.0000
323 T A -0.2608
324 I A 0.0000
325 Y A 0.0000
326 W A 0.1525
327 F A 0.0000
328 T A 0.0524
329 V A 0.0000
330 E A -0.2069
331 F A 0.0000
332 G A 0.0000
333 L A 0.0000
334 C A 0.0000
335 K A -2.4455
336 Q A -2.0987
337 G A -2.3214
338 D A -2.3144
339 S A -1.3025
340 I A -0.1520
341 K A -0.2372
342 A A 0.0000
343 Y A 0.0000
344 G A 0.0000
345 A A 0.0000
346 G A 0.0000
347 L A 0.0000
348 L A 0.0000
349 S A 0.0000
350 S A 0.1946
351 F A 0.5680
352 G A 0.5338
353 E A 0.1695
354 L A 0.0000
355 Q A -0.0209
356 Y A -0.1511
357 C A 0.0000
358 L A 0.5856
359 S A -0.8762
360 E A -2.5810
361 K A -2.6401
362 P A -1.5560
363 K A -1.5853
364 L A 0.4173
365 L A 0.0000
366 P A -0.1355
367 L A -0.4382
368 E A -1.5878
369 L A 0.0000
370 E A -2.4870
371 K A -2.4429
372 T A 0.0000
373 A A -0.8933
374 I A 0.1914
375 Q A -1.0515
376 N A -1.0459
377 Y A -0.1535
378 T A -0.1585
379 V A 0.3895
380 T A -0.3291
381 E A -0.8297
382 F A -0.1525
383 Q A -1.3448
384 P A -0.8689
385 L A 0.0000
386 Y A 0.0000
387 Y A 0.0000
388 V A -0.2621
389 A A 0.0000
390 E A -2.6380
391 S A -1.8570
392 F A -1.5792
393 N A -2.2662
394 D A -2.5646
395 A A -2.0198
396 K A 0.0000
397 E A -3.2067
398 K A -2.4473
399 V A -1.7256
400 R A -2.4635
401 N A -2.2509
402 F A -1.1490
403 A A 0.0000
404 A A -0.9894
405 T A -0.3866
406 I A -0.1376
407 P A -0.3320
408 R A -0.5649
409 P A -0.3142
410 F A 0.2350
411 S A 0.0551
412 V A 0.0935
413 R A -1.5300
414 Y A -1.4345
415 D A -1.4313
416 P A -0.4890
417 Y A 0.5954
418 T A -0.4470
419 Q A -1.4337
420 R A -2.3947
421 I A 0.0000
422 E A -0.9118
423 V A 0.3258
424 L A 0.7551
425 D A -0.7657

Above is the comparison between the input structure and the most aggregation prone model (predicted in the flexibility simulations, download both models in the PDB file format , download table with rmsd values ). The picture presents the most aggregation prone model (in blue) superimposed on the input structure (in red). The plot shows rmsd profile (distances between residues of the superimposed structures).

Dynamic mode uses CABS-flex simulations of protein structure fluctuations. The structure fluctuations may have impact on the size and extent of aggregation "hot-spots" on the protein surface. The dynamic mode uses the following pipeline: (1) based on the input structure, CABS-flex predicts a set of different models reflecting protein dynamics in solution; (2) for each of these models A3D score is calculated; (3) finally, the most aggregation prone model (the model with the highest A3D score, -0.7052 in this case) is selected and presented in A3D results.


 

Laboratory of Theory of Biopolymers 2015