Project name: ac809538e37ddc [mutate: IA1V]

Status: done

submitted: 2019-03-14 14:28:30, status changed: 2019-03-14 14:33:08
Settings
Chain sequence(s) A: IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues IA1V
Energy difference between WT (input) and mutated protein (by FoldX) 0.778651 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.2186
Maximal score value
0.1392
Average score
-1.1333
Total score value
-112.2007

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A -0.0117 mutated: IA1V
2 D A -1.0425
3 V A 0.0000
4 L A -0.2747
5 L A 0.0000
6 G A 0.0000
7 A A -1.3466
8 D A -2.6894
9 D A -2.8698
10 G A -1.8110
11 S A -0.9397
12 L A -0.0979
13 A A 0.1392
14 F A 0.0000
15 V A 0.0087
16 P A -0.3298
17 S A -0.6952
18 E A -1.9117
19 F A -0.7318
20 S A -1.0658
21 I A 0.0000
22 S A -1.6661
23 P A -1.8702
24 G A -1.5138
25 E A -1.8169
26 K A -2.3206
27 I A 0.0000
28 V A -1.1795
29 F A 0.0000
30 K A -1.4590
31 N A 0.0000
32 N A -1.3661
33 A A -1.2160
34 G A -0.8381
35 F A -0.2510
36 P A -0.5504
37 H A 0.0000
38 N A 0.0000
39 I A 0.0000
40 V A 0.0000
41 F A 0.0000
42 D A -2.1230
43 E A -3.2186
44 D A -2.9228
45 S A -2.1398
46 I A -2.1045
47 P A -1.7535
48 S A -1.2726
49 G A -0.8343
50 V A -1.3179
51 D A -2.0569
52 A A -2.0737
53 S A -1.6384
54 K A -2.1057
55 I A 0.0000
56 S A -1.4896
57 M A -1.1248
58 S A -1.8623
59 E A -2.9589
60 E A -3.1081
61 D A -2.3430
62 L A -0.8149
63 L A 0.0000
64 N A -1.5801
65 A A -1.6414
66 K A -2.4682
67 G A -1.9007
68 E A -1.6912
69 T A -1.3618
70 F A -0.8304
71 E A -1.9881
72 V A 0.0000
73 A A -1.7573
74 L A 0.0000
75 S A -1.8538
76 N A -2.6765
77 K A -3.2022
78 G A -2.3724
79 E A -2.5131
80 Y A 0.0000
81 S A -1.4841
82 F A 0.0000
83 Y A -0.3276
84 C A 0.0000
85 S A -1.1681
86 P A -0.8934
87 H A -0.5973
88 Q A -0.9712
89 G A -0.9381
90 A A -0.5223
91 G A -0.5156
92 M A 0.0000
93 V A 0.0873
94 G A 0.0000
95 K A -1.6675
96 V A 0.0000
97 T A -2.0306
98 V A 0.0000
99 N A -2.3543

 

Laboratory of Theory of Biopolymers 2015