Project name: a00e61f95a94cee

Chain sequence(s)	A: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Distance of aggregation	10 Å
Dynamic mode	No

• Minimal score value: -3.0563
• Maximal score value: 3.7059
• Average score: -0.1544
• Total score value: -6.1754

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	D	A	-2.2314
2	A	A	-2.5753
3	E	A	-2.5685
4	F	A	-0.9637
5	R	A	-2.6176
6	H	A	-3.0563
7	D	A	-2.9753
8	S	A	-1.7060
9	G	A	-1.4522
10	Y	A	-0.4364
11	E	A	-1.8563
12	V	A	-1.3282
13	H	A	-1.7412
14	H	A	-1.3102
15	Q	A	-0.7982
16	K	A	-0.6799
17	L	A	0.8945
18	V	A	1.5217
19	F	A	1.3225
20	F	A	1.0746
21	A	A	0.5119
22	E	A	-0.9569
23	D	A	-1.4065
24	V	A	-0.4427
25	G	A	-1.4593
26	S	A	-1.8647
27	N	A	-1.8596
28	K	A	-1.5350
29	G	A	-0.6920
30	A	A	0.3457
31	I	A	1.4315
32	I	A	2.1558
33	G	A	2.1575
34	L	A	3.2073
35	M	A	3.3240
36	V	A	3.7059
37	G	A	2.8789
38	G	A	1.8272
39	V	A	2.7785
40	V	A	3.2005