Project name: SH3_N135L

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	NA135L
Energy difference between WT (input) and mutated protein (by FoldX)	-0.67311 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4888
• Maximal score value: 1.5598
• Average score: -0.7589
• Total score value: -45.534

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1067
87	V	A	-0.6277
88	A	A	0.0000
89	L	A	0.0890
90	Y	A	-0.4420
91	D	A	-2.8652
92	Y	A	-2.1142
93	E	A	-2.8821
94	S	A	0.0000
95	R	A	-2.7838
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3230
100	L	A	0.0000
101	S	A	-1.9038
102	F	A	0.0000
103	K	A	-3.4888
104	K	A	-2.8724
105	G	A	-1.9657
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4370
111	V	A	1.2498
112	N	A	-0.4200
113	N	A	-1.8145
114	T	A	-1.7328
115	E	A	-2.9365
116	G	A	-2.2968
117	D	A	-2.1768
118	W	A	-0.9524
119	W	A	-0.4057
120	L	A	0.4044
121	A	A	0.0000
122	H	A	-0.3840
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4950
130	G	A	0.0000
131	Y	A	0.2194
132	I	A	0.0000
133	P	A	0.0000
134	S	A	0.0859
135	L	A	1.5598	mutated: NA135L
136	Y	A	1.1320
137	V	A	0.0000
138	A	A	0.4982
139	P	A	-0.1505
140	S	A	-0.1759