Project name: SH3_S82H

Status: done

submitted: 2019-03-14 15:07:53, status changed: 2019-03-14 15:15:44
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues SA82H
Energy difference between WT (input) and mutated protein (by FoldX) 0.0909677 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4838
Maximal score value
1.3238
Average score
-0.9054
Total score value
-54.321

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.8022
82 H A -1.4210 mutated: SA82H
83 H A -1.1409
84 M A 0.0889
85 T A 0.0000
86 F A -0.0405
87 V A -0.5893
88 A A 0.0000
89 L A -0.3125
90 Y A -0.7367
91 D A -2.8528
92 Y A -2.1055
93 E A -2.8815
94 S A 0.0000
95 R A -2.7837
96 T A -2.1540
97 E A -2.3526
98 T A -1.2408
99 D A -1.3222
100 L A 0.0000
101 S A -1.9031
102 F A 0.0000
103 K A -3.4838
104 K A -2.8616
105 G A -1.9621
106 E A 0.0000
107 R A -1.9941
108 L A 0.0000
109 Q A -0.0971
110 I A 0.4797
111 V A 1.3238
112 N A -0.3871
113 N A -1.8138
114 T A -1.7326
115 E A -2.9361
116 G A -2.6085
117 D A -2.6844
118 W A -1.3421
119 W A -0.6949
120 L A 0.4462
121 A A 0.0000
122 H A -0.2534
123 S A 0.0000
124 L A -0.1472
125 T A -0.7398
126 T A -0.8464
127 G A -0.7731
128 Q A -1.3849
129 T A -0.4421
130 G A 0.0000
131 Y A 0.2238
132 I A 0.0000
133 P A 0.0000
134 S A -1.2855
135 N A -1.2485
136 Y A -0.2039
137 V A 0.0000
138 A A -0.0212
139 P A -0.1240
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015