Project name: SH3_G127C

Status: done

submitted: 2019-03-14 15:35:52, status changed: 2019-03-14 18:11:32
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues GA127C
Energy difference between WT (input) and mutated protein (by FoldX) 3.4315 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4823
Maximal score value
1.2506
Average score
-0.8423
Total score value
-50.5385

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4510
82 S A -0.6826
83 H A -0.7912
84 M A 0.2668
85 T A 0.0000
86 F A -0.1044
87 V A -0.6223
88 A A 0.0000
89 L A -0.3125
90 Y A -0.7367
91 D A -2.8528
92 Y A -2.1055
93 E A -2.8815
94 S A 0.0000
95 R A -2.7837
96 T A -2.1540
97 E A -2.3526
98 T A -1.2414
99 D A -1.3229
100 L A 0.0000
101 S A -1.9021
102 F A 0.0000
103 K A -3.4823
104 K A -2.8616
105 G A -1.9619
106 E A 0.0000
107 R A -2.1102
108 L A 0.0000
109 Q A -0.2765
110 I A 0.4381
111 V A 1.2506
112 N A -0.4196
113 N A -1.8142
114 T A -1.7328
115 E A -2.9363
116 G A -2.6085
117 D A -2.6844
118 W A -1.3424
119 W A -0.6974
120 L A 0.4054
121 A A 0.0000
122 H A -0.1464
123 S A 0.0000
124 L A -0.0178
125 T A -0.5178
126 T A -0.3364
127 C A 0.3100 mutated: GA127C
128 Q A -0.8617
129 T A -0.2385
130 G A 0.0000
131 Y A 0.2202
132 I A 0.0000
133 P A 0.0000
134 S A -1.2857
135 N A -1.2485
136 Y A -0.2039
137 V A 0.0000
138 A A -0.0212
139 P A -0.1505
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015