Project name: SH3_D99Y

Status: done

submitted: 2019-03-14 15:19:55, status changed: 2019-03-14 16:34:57
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues DA99Y
Energy difference between WT (input) and mutated protein (by FoldX) -1.65752 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4649
Maximal score value
1.2447
Average score
-0.8901
Total score value
-53.4063

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4510
82 S A -0.6826
83 H A -0.7912
84 M A 0.2668
85 T A 0.0000
86 F A -0.1069
87 V A -0.6232
88 A A 0.0000
89 L A -0.3026
90 Y A -0.7113
91 D A -2.8208
92 Y A -1.9704
93 E A -2.7531
94 S A -1.9412
95 R A -2.6386
96 T A -1.9209
97 E A -2.1399
98 T A -0.8877
99 Y A -0.6004 mutated: DA99Y
100 L A 0.0000
101 S A -1.7195
102 F A 0.0000
103 K A -3.4649
104 K A -2.8475
105 G A -1.9578
106 E A 0.0000
107 R A -2.0714
108 L A 0.0000
109 Q A -0.2489
110 I A 0.4321
111 V A 1.2447
112 N A -0.4457
113 N A -1.8490
114 T A -1.7534
115 E A -2.9771
116 G A -2.6504
117 D A -2.7621
118 W A -1.4171
119 W A -0.7006
120 L A 0.4703
121 A A 0.0000
122 H A -0.3905
123 S A 0.0000
124 L A -0.2796
125 T A -0.7803
126 T A -0.8781
127 G A -0.8169
128 Q A -1.3344
129 T A -0.3709
130 G A 0.0000
131 Y A 0.4512
132 I A 0.0000
133 P A 0.0000
134 S A -1.3483
135 N A -1.2802
136 Y A -0.2325
137 V A 0.0000
138 A A -0.0261
139 P A -0.1505
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015