Project name: a39d341047cde77 [mutate: PA42G]

Status: done

submitted: 2018-12-24 05:36:59, status changed: 2018-12-24 08:25:12
Settings
Chain sequence(s) A: MKFLLFTLLTFLVSADVVSLNPTNFNTIVDGSKHVFVKFFAPWCGHCKKLAPEYIKLADAYKDKQDIVIAELDCDNKDHKDLCGKFGISGFPTLKFFRKGTTEPIEYEGGRTVEDLSHFIQEKIQPKAPSNVVSVTTATFDSIVMDPTKNVFVKFFAPWCGHCKALAPKYIEVSKMYAGEDDLVVAEVDCTANQETCNKYEVHGYPTLKSFPKGENKKPIAYEGGREVKDFVTYFNTNYGYDRDENGKLGKTAGRIAELDDLAKGFANKENKDEIIKKAEAIEGGAYYVKVMKRIIERGADYVEKEKARINKILENPSMKAKKIDDFTRNLNVLEVF
Distance of aggregation 5 Å
Dynamic mode Yes
Mutated residues PA42G
Energy difference between WT (input) and mutated protein (by FoldX) 2.55641 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-2.4217
Maximal score value
2.0776
Average score
-0.3689
Total score value
-124.3061

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.9672
2 K A -1.1262
3 F A 2.0206
4 L A 2.0080
5 L A 0.9799
6 F A 0.5813
7 T A 0.3095
8 L A 1.7530
9 L A 1.4504
10 T A 0.4353
11 F A 1.5144
12 L A 2.0776
13 V A 2.0275
14 S A 0.1919
15 A A -0.0210
16 D A -0.2631
17 V A 0.1993
18 V A 0.0000
19 S A -0.1246
20 L A 0.0000
21 N A -0.1938
22 P A -0.0667
23 T A -0.0433
24 N A 0.0000
25 F A 0.0000
26 N A -0.3551
27 T A -0.2667
28 I A 0.3294
29 V A 0.0000
30 D A -1.9240
31 G A -0.7792
32 S A -0.5078
33 K A -1.1510
34 H A 0.0000
35 V A 0.0000
36 F A 0.0000
37 V A 0.0000
38 K A 0.0000
39 F A 0.0000
40 F A 0.1444
41 A A 0.3147
42 G A 0.0824 mutated: PA42G
43 W A 1.2037
44 C A 0.4002
45 G A -0.7373
46 H A -0.8737
47 C A 0.0000
48 K A -2.0779
49 K A -2.0313
50 L A 0.0000
51 A A -0.2394
52 P A -0.3953
53 E A -0.9130
54 Y A 0.0000
55 I A 0.4946
56 K A -1.6813
57 L A 0.0000
58 A A 0.0000
59 D A -1.3868
60 A A -0.1660
61 Y A -0.6411
62 K A -2.0236
63 D A -2.4217
64 K A -2.2513
65 Q A -1.8435
66 D A -1.8887
67 I A 0.6594
68 V A 1.9501
69 I A 0.6718
70 A A 0.0720
71 E A 0.0000
72 L A 0.0000
73 D A -0.4161
74 C A 0.0000
75 D A -0.6960
76 N A -0.6050
77 K A -2.0519
78 D A -2.1206
79 H A -0.6532
80 K A -1.1345
81 D A -0.6207
82 L A 0.0000
83 C A 0.0000
84 G A 0.0000
85 K A -0.3811
86 F A 0.0000
87 G A 0.0238
88 I A 1.0432
89 S A -0.0495
90 G A -0.0060
91 F A 1.8841
92 P A 0.0000
93 T A 0.2745
94 L A 0.0000
95 K A 0.0000
96 F A 0.0000
97 F A 0.0000
98 R A -0.3341
99 K A -0.5259
100 G A -0.6612
101 T A -0.1456
102 T A -0.1982
103 E A -0.9559
104 P A -0.1838
105 I A 0.1868
106 E A -0.9271
107 Y A -0.0892
108 E A -0.5713
109 G A -0.5538
110 G A 0.0000
111 R A -0.9026
112 T A -0.1008
113 V A 0.4851
114 E A -1.8657
115 D A -1.4363
116 L A 0.0000
117 S A -0.1311
118 H A -0.6969
119 F A 0.2102
120 I A 0.1027
121 Q A -0.7317
122 E A -0.5713
123 K A 0.0000
124 I A 1.6790
125 Q A -0.8467
126 P A -0.7899
127 K A -1.7423
128 A A -0.3388
129 P A -0.2852
130 S A -0.4629
131 N A -1.0163
132 V A 0.4408
133 V A 1.7847
134 S A 0.1512
135 V A 0.0000
136 T A -0.0709
137 T A 0.0000
138 A A 0.0109
139 T A -0.0487
140 F A 0.0000
141 D A -0.4249
142 S A -0.1068
143 I A 0.3528
144 V A 0.0000
145 M A 0.6921
146 D A -1.6382
147 P A -0.7906
148 T A -0.3200
149 K A -1.3978
150 N A -0.3882
151 V A 0.0000
152 F A 0.0000
153 V A 0.0000
154 K A -0.1561
155 F A 0.0000
156 F A 0.2653
157 A A 0.0622
158 P A 0.1642
159 W A 1.1765
160 C A 0.0000
161 G A -0.1970
162 H A -0.4338
163 C A -0.0331
164 K A -0.3145
165 A A -0.0049
166 L A 0.1931
167 A A 0.0151
168 P A -0.1521
169 K A -0.7796
170 Y A -0.0437
171 I A 0.3441
172 E A -1.7457
173 V A 0.0000
174 S A 0.0000
175 K A -0.7945
176 M A 0.2655
177 Y A 0.0000
178 A A -0.0953
179 G A -0.0853
180 E A -0.6010
181 D A -1.9060
182 D A -0.6997
183 L A 0.0000
184 V A 0.7013
185 V A 0.0000
186 A A 0.0000
187 E A -0.4168
188 V A 0.0000
189 D A -0.3691
190 C A 0.0000
191 T A -0.1461
192 A A -0.0614
193 N A -0.7645
194 Q A -1.6100
195 E A -2.0392
196 T A -0.3569
197 C A 0.0000
198 N A -1.4854
199 K A -1.8337
200 Y A -0.2261
201 E A -1.6913
202 V A -0.2384
203 H A -1.0247
204 G A -0.4372
205 Y A 1.0042
206 P A 0.0968
207 T A 0.0000
208 L A 0.1490
209 K A 0.0000
210 S A 0.0886
211 F A 0.0000
212 P A -0.3786
213 K A -1.7321
214 G A 0.0000
215 E A -1.4285
216 N A -1.8309
217 K A -2.2798
218 K A -2.0829
219 P A -0.3954
220 I A 0.9900
221 A A 0.3115
222 Y A 0.1095
223 E A -1.4709
224 G A -0.8066
225 G A -0.9150
226 R A -2.2361
227 E A -2.1126
228 V A -0.6332
229 K A -1.9875
230 D A -2.0249
231 F A 0.0000
232 V A 0.0000
233 T A -0.0826
234 Y A 0.3511
235 F A 0.0000
236 N A -0.8414
237 T A -0.4255
238 N A -1.0394
239 Y A 0.2881
240 G A -0.0142
241 Y A 0.0658
242 D A -1.4961
243 R A -2.2578
244 D A -1.4022
245 E A 0.0000
246 N A -0.1634
247 G A 0.0000
248 K A -0.2745
249 L A 0.0000
250 G A -0.7821
251 K A -1.7866
252 T A 0.0000
253 A A -0.0483
254 G A -0.5040
255 R A -0.3717
256 I A 0.1710
257 A A -0.2007
258 E A -0.8369
259 L A 0.0000
260 D A -1.2851
261 D A -1.7189
262 L A 1.0234
263 A A -0.1804
264 K A -1.7278
265 G A -0.4300
266 F A 0.3389
267 A A 0.0000
268 N A -1.5795
269 K A -2.2556
270 E A -2.2012
271 N A -1.0538
272 K A -2.0994
273 D A -2.4206
274 E A -1.7693
275 I A 1.7643
276 I A 0.4969
277 K A -1.8013
278 K A -1.3137
279 A A -0.2344
280 E A -0.7528
281 A A 0.0000
282 I A 1.3294
283 E A -1.5202
284 G A 0.0000
285 G A 0.0513
286 A A 0.0696
287 Y A 0.3464
288 Y A 0.0000
289 V A 1.4759
290 K A -1.3904
291 V A 0.0000
292 M A 0.0000
293 K A -1.4480
294 R A -1.1579
295 I A 0.0000
296 I A 0.2057
297 E A -1.8662
298 R A -1.2090
299 G A -0.6189
300 A A 0.0000
301 D A -1.6107
302 Y A 0.4965
303 V A 0.0000
304 E A -1.0558
305 K A -1.2890
306 E A -0.8413
307 K A -0.4832
308 A A -0.3122
309 R A -1.8554
310 I A -0.1651
311 N A -0.5427
312 K A -1.6080
313 I A 0.3759
314 L A 0.1116
315 E A -1.9428
316 N A -1.4669
317 P A -0.4044
318 S A -0.0970
319 M A 0.4733
320 K A -1.5511
321 A A -0.5574
322 K A -1.9869
323 K A -2.1405
324 I A -0.2197
325 D A -0.9060
326 D A -1.7989
327 F A 0.3272
328 T A -0.0253
329 R A -0.2928
330 N A -0.2764
331 L A 0.0000
332 N A -0.6366
333 V A 0.0000
334 L A 0.0000
335 E A -1.7806
336 V A 0.0083
337 F A 0.6722

Above is the comparison between the input structure and the most aggregation prone model (predicted in the flexibility simulations, download both models in the PDB file format , download table with rmsd values ). The picture presents the most aggregation prone model (in blue) superimposed on the input structure (in red). The plot shows rmsd profile (distances between residues of the superimposed structures).

Dynamic mode uses CABS-flex simulations of protein structure fluctuations. The structure fluctuations may have impact on the size and extent of aggregation "hot-spots" on the protein surface. The dynamic mode uses the following pipeline: (1) based on the input structure, CABS-flex predicts a set of different models reflecting protein dynamics in solution; (2) for each of these models A3D score is calculated; (3) finally, the most aggregation prone model (the model with the highest A3D score, -0.3689 in this case) is selected and presented in A3D results.


 

Laboratory of Theory of Biopolymers 2015