Project name: a49c8e82ba78cf1

Chain sequence(s)	A: HQGTFTSDLSKQKDSRRAQDFIEWLKNGGPSSGAPPPS
Distance of aggregation	10 Å
Dynamic mode	No

• Minimal score value: -5.1803
• Maximal score value: 0.5519
• Average score: -1.9087
• Total score value: -72.5299

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	H	A	-1.3530
3	Q	A	-1.2525
4	G	A	-0.7865
5	T	A	-0.1413
6	F	A	0.5519
7	T	A	-0.4818
8	S	A	-1.2104
9	D	A	-2.3863
10	L	A	-1.5654
11	S	A	-2.8457
12	K	A	-4.3118
13	Q	A	-3.9672
14	K	A	-4.9032
15	D	A	-5.1803
16	S	A	-4.0561
17	R	A	-4.9835
18	R	A	-4.8970
19	A	A	-3.2443
20	Q	A	-3.1837
21	D	A	-3.3480
22	F	A	-1.3737
23	I	A	-0.8865
24	E	A	-2.4847
25	W	A	-1.3764
26	L	A	-0.4650
27	K	A	-2.1838
28	N	A	-2.2605
29	G	A	-1.3245
30	G	A	0.0000
31	P	A	-0.5912
32	S	A	-0.8893
33	S	A	-1.2486
34	G	A	-0.8896
35	A	A	-0.5795
36	P	A	-0.5224
37	P	A	-0.3534
38	P	A	-0.9201
39	S	A	-0.6346