Project name: SH3_Q109D

Status: done

submitted: 2019-03-14 15:23:54, status changed: 2019-03-14 16:59:30
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues QA109D
Energy difference between WT (input) and mutated protein (by FoldX) 0.908291 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4838
Maximal score value
1.1678
Average score
-0.8964
Total score value
-53.7869

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4810
82 S A -0.7189
83 H A -0.8275
84 M A 0.1832
85 T A 0.0000
86 F A -0.1500
87 V A -0.6312
88 A A 0.0000
89 L A -0.3125
90 Y A -0.7367
91 D A -2.8528
92 Y A -2.1055
93 E A -2.8815
94 S A 0.0000
95 R A -2.7837
96 T A -2.1540
97 E A -2.3526
98 T A -1.2409
99 D A -1.3224
100 L A 0.0000
101 S A -1.9030
102 F A 0.0000
103 K A -3.4838
104 K A -2.8616
105 G A -1.9621
106 E A 0.0000
107 R A -2.0039
108 L A 0.0000
109 D A -0.3324 mutated: QA109D
110 I A 0.2902
111 V A 1.1678
112 N A -0.4623
113 N A -1.8315
114 T A -1.7328
115 E A -2.9363
116 G A -2.6085
117 D A -2.6844
118 W A -1.3424
119 W A -0.7273
120 L A 0.3508
121 A A 0.0000
122 H A -0.4451
123 S A 0.0000
124 L A 0.0268
125 T A -0.6229
126 T A -0.7827
127 G A -0.7126
128 Q A -1.3722
129 T A -0.5088
130 G A 0.0000
131 Y A 0.1953
132 I A 0.0000
133 P A 0.0000
134 S A -1.2940
135 N A -1.2485
136 Y A -0.2039
137 V A 0.0000
138 A A -0.0212
139 P A -0.1775
140 S A -0.1881

 

Laboratory of Theory of Biopolymers 2015