Project name: SH3_S134R

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	SA134R
Energy difference between WT (input) and mutated protein (by FoldX)	-0.222051 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.5021
• Maximal score value: 1.2439
• Average score: -1.0099
• Total score value: -60.5961

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4503
82	S	A	-0.6820
83	H	A	-0.7912
84	M	A	0.2690
85	T	A	0.0000
86	F	A	-0.0969
87	V	A	-0.6279
88	A	A	0.0000
89	L	A	-0.3468
90	Y	A	-0.8089
91	D	A	-2.8881
92	Y	A	-2.1235
93	E	A	-2.8817
94	S	A	0.0000
95	R	A	-2.7840
96	T	A	-2.1546
97	E	A	-2.3531
98	T	A	-1.2422
99	D	A	-1.3295
100	L	A	0.0000
101	S	A	-1.9038
102	F	A	0.0000
103	K	A	-3.5021
104	K	A	-2.8920
105	G	A	-1.9744
106	E	A	0.0000
107	R	A	-2.0690
108	L	A	0.0000
109	Q	A	-0.2448
110	I	A	0.2458
111	V	A	1.2439
112	N	A	-0.4318
113	N	A	-2.0690
114	T	A	-1.7411
115	E	A	-3.1513
116	G	A	-2.9813
117	D	A	-3.2444
118	W	A	-1.9202
119	W	A	-1.2159
120	L	A	0.1759
121	A	A	0.0000
122	H	A	-0.3873
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4120
129	T	A	-0.4947
130	G	A	0.0000
131	Y	A	-0.0244
132	I	A	0.0000
133	P	A	0.0000
134	R	A	-3.0421	mutated: SA134R
135	N	A	-2.1147
136	Y	A	-0.7884
137	V	A	0.0000
138	A	A	-0.2899
139	P	A	-0.1471
140	S	A	-0.1735