Project name: SH3_F86R

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	FA86R
Energy difference between WT (input) and mutated protein (by FoldX)	3.36733 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.2534
• Average score: -0.9462
• Total score value: -56.7698

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.5385
82	S	A	-0.8025
83	H	A	-0.9954
84	M	A	-0.2432
85	T	A	0.0000
86	R	A	-0.6259	mutated: FA86R
87	V	A	-0.8360
88	A	A	0.0000
89	L	A	-0.3651
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3276
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-2.0148
106	E	A	0.0000
107	R	A	-2.1935
108	L	A	0.0000
109	Q	A	-0.4314
110	I	A	0.3045
111	V	A	1.2534
112	N	A	-0.4259
113	N	A	-1.8245
114	T	A	-1.7407
115	E	A	-2.9462
116	G	A	-2.6170
117	D	A	-2.6939
118	W	A	-1.3627
119	W	A	-0.7336
120	L	A	0.3909
121	A	A	0.0000
122	H	A	-0.3824
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4925
130	G	A	0.0000
131	Y	A	0.2086
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2943
135	N	A	-1.2528
136	Y	A	-0.2510
137	V	A	0.0000
138	A	A	-0.1651
139	P	A	-0.4253
140	S	A	-0.4217