Project name: SH3_Q128G

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	QA128G
Energy difference between WT (input) and mutated protein (by FoldX)	0.63274 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4895
• Maximal score value: 1.2496
• Average score: -0.8435
• Total score value: -50.6098

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1044
87	V	A	-0.6223
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8542
92	Y	A	-2.1082
93	E	A	-2.8848
94	S	A	0.0000
95	R	A	-2.7849
96	T	A	-2.1550
97	E	A	-2.3526
98	T	A	-1.2425
99	D	A	-1.2173
100	L	A	0.0000
101	S	A	-1.7471
102	F	A	0.0000
103	K	A	-3.4895
104	K	A	-2.8616
105	G	A	-1.9623
106	E	A	0.0000
107	R	A	-2.0766
108	L	A	0.0000
109	Q	A	-0.2493
110	I	A	0.4370
111	V	A	1.2496
112	N	A	-0.4200
113	N	A	-1.8142
114	T	A	-1.7328
115	E	A	-2.9363
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3424
119	W	A	-0.6978
120	L	A	0.4043
121	A	A	0.0000
122	H	A	-0.1030
123	S	A	0.0000
124	L	A	-0.1101
125	T	A	-0.6399
126	T	A	-0.5876
127	G	A	-0.3533
128	G	A	-0.3895	mutated: QA128G
129	T	A	0.0064
130	G	A	0.0000
131	Y	A	0.2182
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2857
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1505
140	S	A	-0.1759