Project name: ad62b486d0a45c6

Chain sequence(s)	A: TQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE
Distance of aggregation	10 Å
Dynamic mode	No

• Minimal score value: -3.2938
• Maximal score value: 2.6725
• Average score: -0.3758
• Total score value: -29.6894

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	T	A	-1.2005
2	Q	A	-1.6347
3	Q	A	-1.8013
4	P	A	-1.6123
5	Q	A	-1.8586
6	Q	A	-2.2324
7	D	A	-2.2767
8	E	A	-2.1813
9	M	A	-0.2282
10	P	A	0.2441
11	S	A	-0.2121
12	P	A	0.2481
13	T	A	0.2187
14	F	A	0.3759
15	L	A	1.7424
16	T	A	0.3106
17	Q	A	-0.1804
18	V	A	0.5958
19	K	A	-1.3366
20	E	A	-2.0256
21	S	A	-0.1474
22	L	A	0.9585
23	S	A	-0.0408
24	S	A	-0.3650
25	Y	A	1.1078
26	W	A	0.8700
27	E	A	-1.0762
28	S	A	-0.7573
29	A	A	-0.4176
30	K	A	-1.4721
31	T	A	-1.1288
32	A	A	-0.7821
33	A	A	-0.5191
34	Q	A	-1.3297
35	N	A	-1.0390
36	L	A	0.6927
37	Y	A	0.7485
38	E	A	-1.0133
39	K	A	-0.1397
40	T	A	0.8307
41	Y	A	1.3952
42	L	A	1.0228
43	P	A	-0.0565
44	A	A	-0.7170
45	V	A	-0.4788
46	D	A	-2.6058
47	E	A	-3.2938
48	K	A	-2.4356
49	L	A	-1.4620
50	R	A	-2.8661
51	D	A	-2.9491
52	L	A	-0.6295
53	Y	A	-0.1461
54	S	A	-1.0171
55	K	A	-1.5464
56	S	A	-0.2112
57	T	A	-0.0059
58	A	A	-0.0314
59	A	A	0.2333
60	M	A	1.2735
61	S	A	0.8267
62	T	A	1.4198
63	Y	A	2.5117
64	T	A	1.5019
65	G	A	1.0414
66	I	A	2.4147
67	F	A	2.6725
68	T	A	1.1845
69	D	A	-0.1442
70	Q	A	0.0064
71	V	A	1.3328
72	L	A	1.1779
73	S	A	-0.0493
74	V	A	0.3115
75	L	A	-0.1117
76	K	A	-1.8711
77	G	A	-1.8180
78	E	A	-2.6253
79	E	A	-2.8791