Project name: SH3_S94M

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	SA94M
Energy difference between WT (input) and mutated protein (by FoldX)	2.15213 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.47
• Maximal score value: 1.2507
• Average score: -0.8989
• Total score value: -53.9361

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1031
87	V	A	-0.6191
88	A	A	0.0000
89	L	A	-0.3019
90	Y	A	-0.7194
91	D	A	-2.8332
92	Y	A	-1.9900
93	E	A	-2.6934
94	M	A	-1.8074	mutated: SA94M
95	R	A	-2.6039
96	T	A	-2.0155
97	E	A	-2.2638
98	T	A	-1.1321
99	D	A	-1.0983
100	L	A	0.0000
101	S	A	-1.7232
102	F	A	0.0000
103	K	A	-3.4700
104	K	A	-2.8534
105	G	A	-1.9600
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2489
110	I	A	0.4379
111	V	A	1.2507
112	N	A	-0.4176
113	N	A	-1.8112
114	T	A	-1.7310
115	E	A	-2.9328
116	G	A	-2.6050
117	D	A	-2.6779
118	W	A	-1.3138
119	W	A	-0.6772
120	L	A	0.4280
121	A	A	0.0000
122	H	A	-0.3825
123	S	A	0.0000
124	L	A	-0.2794
125	T	A	-0.7803
126	T	A	-0.8734
127	G	A	-0.8165
128	Q	A	-1.3929
129	T	A	-0.4662
130	G	A	0.0000
131	Y	A	0.3203
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2777
135	N	A	-1.2400
136	Y	A	-0.1863
137	V	A	0.0000
138	A	A	-0.0189
139	P	A	-0.1505
140	S	A	-0.1759