Project name: SH3_S134T

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	SA134T
Energy difference between WT (input) and mutated protein (by FoldX)	1.27173 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4824
• Maximal score value: 1.2459
• Average score: -0.8952
• Total score value: -53.7126

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4514
82	S	A	-0.6830
83	H	A	-0.7912
84	M	A	0.2654
85	T	A	0.0000
86	F	A	-0.1092
87	V	A	-0.6236
88	A	A	0.0000
89	L	A	-0.3102
90	Y	A	-0.7310
91	D	A	-2.8500
92	Y	A	-2.1041
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3241
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4824
104	K	A	-2.8592
105	G	A	-1.9616
106	E	A	0.0000
107	R	A	-2.0730
108	L	A	0.0000
109	Q	A	-0.2519
110	I	A	0.4323
111	V	A	1.2459
112	N	A	-0.4243
113	N	A	-1.8166
114	T	A	-1.7349
115	E	A	-2.9367
116	G	A	-2.6069
117	D	A	-2.6811
118	W	A	-1.3419
119	W	A	-0.7045
120	L	A	0.4006
121	A	A	0.0000
122	H	A	-0.3861
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4953
130	G	A	0.0000
131	Y	A	0.2180
132	I	A	0.0000
133	P	A	0.0000
134	T	A	-1.2706	mutated: SA134T
135	N	A	-1.2400
136	Y	A	-0.1968
137	V	A	0.0000
138	A	A	-0.0198
139	P	A	-0.1527
140	S	A	-0.1774